Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074269 (2410076I21Rik)
Chromosomal location
Chr 9: 58500686 - 58589364 (-)
Description
RIKEN cDNA 2410076I21 gene Gene [Source:MGI Symbol;Acc:MGI:1920923]
MGI
MGI:1920923 
Uniprot/SWISSPROT
Q9CWH4 
Human Ortholog
ENSG00000183324 (C15orf60)
Omim not available
UniTrap UNI30606
Vector Insertion
Chr 9: 58513639 - 58559913
Public Clones IST15006H12 (tigm) IST12758A7BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24961
Vector Insertion
Chr 9: 58508179 - 58513639
Public Clones not available
Private Clones OST199612 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098674
Sequence
GGACCTTTGACAGGCATGTCTGAAGCGGGAAATGTGGCCTCCGGCCTCGGACTTCCAGGCGAAGTCTCCCAGTGGTCTCTGAAGCGCTATGGTCGCTTCA

TGCTCTTGGACAACGTGGGGTCCCCTGGGCCTAGCTCGGAAGCTGCTGCAGCGGGCTCGCCCACATGGAAG - UNI30606 - GTTTTTGAATCCAGT

GAAGAATCCGGGAGTCTTGTCCTCACGATCGTTGTATCAGGTCACTTCTTCATTTCCCAAGGGCAGACACTGCTG - UNI30606 - GAAGGGTTTTC

ACTCATTGGCAGCAAGAACTGGTTGAAGATTGTAAGACGCATGGACTGTCTTCTGTTTGGAACAACAATAAAG - UNI24961 - - UNI30606 - 

AACAAGAGCCGAATGTTTCGTGTCCAGTTTAGTGGGGAGTCCAAGGAAGAGGCGCTGGAGCGCTGCTGTGGCTGTGTGCAGACCCTGGCCCAGTACGTCA

CCGTTCAGGAGCCTGACAGCACCACCCAGGAGCTTCAGCAGAGCCAAGGCCCCCGGGAGGCAGGTGAAAGCCAAGGGAAGGACCCACTGCAGCAGGGG C

CCTCCCTGACCCTGGAGCAGCACGTGTGTATGGCAGCTGGGGCAGGTGTTCTACAGGAAAGGACCTCAGTGACACATCGAGCTCAG TCTATCCTGGCGC

CAGAGAAGCTGACCCTCGCCTATGAAGGCTCTTCATGGGGAACAGAAGAATTGGGACCTTTTCTACGCTTATGTCTCATGGATCAAAACTTCCCAGCATT

TGTGGAAGAGGTGGAAAAGGAACTTAAAAAGATTACAGGGTTGAGAAACTAAAGCCCTGCACATGTATGCAACTAAGGAACTGAAGGTATTTGAATAAAG

AGTATTATTCCAAGC
Translation
MSEAGNVASGLGLPGEVSQWSLKRYGRFMLLDNVGSPGPSSEAAAAGSPTWK - UNI30606 - VFESSEESGSLVLTIVVSGHFFISQGQTLL - U

NI30606 - EGFSLIGSKNWLKIVRRMDCLLFGTTIK - UNI24961 - - UNI30606 - NKSRMFRVQFSGESKEEALERCCGCVQTLAQYVTV

QEPDSTTQELQQSQGPREAGESQGKDPLQQG PSLTLEQHVCMAAGAGVLQERTSVTHRAQ SILAPEKLTLAYEGSSWGTEELGPFLRLCLMDQNFPAF

VEEVEKELKKITGLRN

For any suggestions or comments, please send an email to unitrap@crg.es