Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074305 (C230081A13Rik)
Chromosomal location
Chr 9: 56052936 - 56265874 (-)
Description
RIKEN cDNA C230081A13 gene Gene [Source:MGI Symbol;Acc:MGI:2442366]
RefSeq_peptide
NP_766512.2 
UniGene
Mm.268105 
MGI
MGI:2442366 
Uniprot/SWISSPROT
Q69Z38 
Human Ortholog
ENSG00000173517 (AC107883.6)
Omim not available
UniTrap UNI19532
Vector Insertion
Chr 9: 56166628 - 56222182
Public Clones (sanger) 5SE171D12 (ggtc) IST13959H5 (tigm) IST14997A10 (tigm)
Private Clones OST389497 (lexicon) OST294941 (lexicon) OST291378 (lexicon) OST66151 (lexicon)
OST65039 (lexicon) OST59155 (lexicon) OST55137 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29362
Vector Insertion
Chr 9: 56108570 - 56166469
Public Clones Ayu21-T78 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31107
Vector Insertion
Chr 9: 56088966 - 56108570
Public Clones IST14391H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12269
Vector Insertion
Chr 9: 56075652 - 56088966
Public Clones A052F08 (ggtc) IST14986F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8782
Vector Insertion
Chr 9: 56055419 - 56074908
Public Clones Xk348 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061552
Sequence
GTGGACTCCGCGGCCGCGAGTAGTTAGTTAGTTGTGTCAGTTGCTCGGTGGAGGCGGCCGCGATCACCAGAAAGGGGACGGGACAGGAGGCAATGCTGAA

TATCGCAACGGCTTGTGCTCCCCTCAG GTGTCTGTCCAACCCAGGACTTATGCGCTAGATGTTTCTTGGTAGCTTGCCTAGAAAACCCAAG - UNI19

532 - TAAACATCGGTACTTTCAGAATATAGGAATGAGAGGCAAGGAAGAAAGGACATTCATCATACGAAGATTTGAATCACTTTGAAACTGTAAAGGG

ATGTAGCACTTGCTGCCAAACTACCTTGCTCACCAGAATGAAGGAAGTGCTTCAGCATTAAATG - UNI29362 - - UNI31105 - ATTGATCGT

ACTTAGAGGAGCTGCTATGACAACATAAGGAGGTGAAAACTCACAGATGCAAATGCAAGTCTTGCTATGCACTGAAGGAAAAGCATTGTCTGCGAAGTTC

TATTTTTAAAAATGTCTGCTTGTAACACCTTTACTGAACACGTTTGGAAACCTGGCGAATGCAAGAATTGCTTTAAACCTAAAAGCTTGCACCAGCTTCC

TCCAGACTCTGAGAAGACGCCCATCACCCACGGCAGTGGGAAAACTAATGCCAATCACAGTAACAACCACCGAGTCAGGAGCACGGGCAACTTCCGGCCC

CCTGTGGCTAAAAAGCCCACCATCGCTGTGAAGCCCACTATGATGGTGGCAGATGGGCAAAGCGTGTGTGGCGAGCTAAGCATCCAGGAACACTGTGAGA

ACAAGCCTGTCATCCTGGGGTGGAACCAAAACAAGACGTCCCTGAGCCAGAAACCACTTAACAACAATTCTGAAGGTGATGCTGAAGGCTTTGGCAGTGA

TCCTCAGCAGTGTGCCAATAATGACAGTGCACAGAAGATATCCAATAACAACAACGGGCTAACTGAAGTGCTAAAGGAGATAGCGGGCCTGGAAGCCACC

CCTCCGGTCAGAGGAAATGAAACAAACGCCAGAGAAACATTCTTGGGAAGAATAAATGATTGCTACAAACGATCGTTGGAAAGAAAGATCCCACCCAGTT

GCATGACCGGGAGCATGAAGGACTCTCAGGGCAAACACGTCATCCTGAGCGGGAGCGCCGAGGTCATCAGTAACGAAGGGGGCAGGTTCTGCTACCCTGA

GTTCTCCAGTGGTGAGGAGAGTGAGGAAGATGTGCTTTTCAGTAACATGGAGGAGGAGCATGAGAGCTGGGATGAGAGCGATGAAGAGCTGTTGGCCATG

GAGATTCGCATGAGAGGGCAGCCTCGCTTTGCTAACTTCAGGGCAAACACCCTGTCTCCTGTTCGATTCTTTGTGAGCAAAAAGTGGAATACTATCCCCT

TACGGAATAAGTCTCTGCAGAGAATCTGTGCTGTGGACTATGACGACAGCTATGATGAAATCCTGAATGGTTATGAGGAAAATTCTGGGGTCTCCTATGG

TCAAGGAAGCGTTCAGAGCACAATATCATCTGACTGCACATCACCAGGCTCCTCCTTCACAGAAGAGTCACGCTCTGAAACAGCCAGCAGTTTATCCCAG

AAGGTCTGTAATGGGGGGATATCTCCTGGTAACCCAGGAAATTCTAAGGACATAGCAGAAACTGAGTCTAATTTTGAAAGTCCTCCTGGTAACAATGAGG

AGAAGGACGAATCACTGACTTCCAAAAGCTCGGTGAAAGTTCCAGAGACGCACAAAGCTGTCCTTGCTCTCCGTTTACAGGAGAAGGATGGCAAGATTGC

AGTACATACTGAGAAGCCAGAGAGCAAAGCTTCTACAGATATCGCTGGCCAGGCAGTCACCATAAGCCTCGTCCCAGTAGAAGAACAGACAAAGCCCTAC

CGTGTGGTAAATCTGGAACAGCCGCTGTGTAAGCCATATACCGTTGTGGATGTGTCGGCAGCCATGGCCAGCGAGCACCTGGGGCGACCCAAGATAAAAG

GTTCATCTTCTACTCCAAACTCTCCAGTTACATCACCTGCATTGACACCAGGACAAATAAATGCCCATCTCAAAAAATCCAGTGCAATCCGATACCAGGA

AGTGTGGACGTCCAGCACCAGTCCACGACAAAAGATCCCTAAAATAGAATTAAGTACTGGGGGACCTGGGCCAAATGTCCCTCCAAGGAAAAACTGCCAT

AAGTCGGCGCCCACTTCACCCACGGCTACAAACATCTCCTCTAAAACCATCCCTGTTAAGTCACCTAATTTGTCTGAAATAAAATTTAATAGTTACAACA

ATGCCGGGATGCCACCTTTTCCCATTATCATCCATGATGAGCCATCCTATGCCCGGAGTTCCAAAAATGCCATTAAAGTCCCCATTGTTATTAATCCAAA

TGCGTATGACAATCTCGCCATCTACAAAAGTTTTCTGGGAACAAGTGGAGAACTCTCTGTGAAGGAAAAAACCACAAGCGTAATAAGCCATACTTACGAA

GAAATAGAAACTGAAAGCAAAGTGTCTGATAGCACCCCCAGCAAGCTCACAGACTGTCCCCAAGCTAAAGGGTTTTCCAACAGCACAGAGCGGAAAAGAG

GCTCAGTAGCGCAGAAGGTGCAGGAGTTTAACAATTGTCTCAACAGAGGTCAGTCTTCTCCACAAAGAAGCTACAGTTCCACCCACAGCTCCCCAGCAAA

AATCCAGAGACCCACTCAAGAGCCTGCGGGCAAAACGGAAGGGGCACAAGGGTCTCAGGTGCCAGGCAGCAGCAGCAACAGCACTAGGGAGAAAGCAAGC

GCCGTCCTATGTCAGATTGTGGCATCTATCCAACCCCCCCAGACTCCTCCAGAAGCACCTCAATCTAGCCCTAAGGCTTGCAGTGTGGAAGAGCTTTATG

CCGTTCCCCCAGATGCAGATACTACAAAAAGTATTCCTAAAAACCCACCAGTCAGACCCAAATCTCTTTTTACATCTCAGTCTAGTGGGGAAGGTGAGGC

CCATCAGACCACAGAAAGCCCTACTGCCAAAATTCAGAAAGATCCATCCACGAAGCCAGTGACTTCTCCTCCCTCCAAATTAGTGACGAGCGCCCAGAGT

GAGCCACCGCCTCCCTTTCCCCCACCACGGTCTACTTCCTCCCCTTACCATGCAAGTAACCTGTTGCAAAGGCATTTTACCAATTGGACGAAGCCAACCA

GTCCTACCCGATCAACAGAAGCTGAATCAATTTTGCACTCTGAAGGCAGCAGGCGAGCCGCTGATGCAAAACCTAAACGCTGGATATCATTTAAAAGCTT

CTTCCGCCGCCGCAAAACAGATGAGGAAGAAGAGAAGGAGAAAGAGCGAGAGAAAGGGAAGCTGGTGGGCCTGGACGGGACAGTCATCCACATGCTGCCG

CCCCCTCCAGTCCAGCGCCATCACTGGTTCACAGAGGCCAAAGGAGAGGCCAGCGAGAAGCCTGCTATAGTCTTCATGTACAGGTGTGACCCTGACCAAG

GCCACCTCAGTGTGGACCAAAGCAAGGCTGGGGCAGAGAAAGGAAGAGCAGAGGAGGTGTTACTGCGGAACTCGGAAGAGAAGAAAAGTAGCTATCTTCC

ATCACAGATTCCTGACAAAGCTTGCAG - UNI31105 - TCGTGTGACCCATGAAGTGGCAGGAGAACTTTCTCCTCGGGATCCAAGAACTCCTGCTG

GGAAGCAAGATGGCACTTCAGTCACACCAACACTGCCTCCACCTGACCTGGAAAGGGAAGAAGAAAAAGATGACACTTTGGATCCTACTGACGTGAGTCC

CTGCAGTGCAACCTACAGCAACCTAG - UNI12269 - - UNI31105 - GACAATCTCGAGCAGCTATGATACCTCCCAAGCATCCACGGCATCCC

AAGGGAGCGGTGGATGATGCCATTGCCTTTGGAGAGAAGACAGACCAAGAAGGACTGAATGCTTCCCAACCCACACCACCCCCACTGCCAAAGAAAATGA

TACGAGCCAATACCGAGCCCATCTCCAAAGACCTTCAGAAAGCCATGGAAAGCAGTCTTTGCGTCATGGCTAATCCCACCTACGATATTGATCCCAACTG

GGATGCCAGCAGTGCTGGGTCTTCTATTAGCTATGAACTCAAGGGACTAGACGTTGAGTCTTATGAATCCTTGGAGAGACCTTTGCATAAGGAGAGACCC

GTTCCTTCAGCAGCAAACAGTATCTCCAGCCTAGCCACTCTCAGTGTTAAGGACAGATTTTCTAACAGTATGGAGTCACTCTCCAGTCGACGTGGTCTCT

CCTATAGACAGACTCGAAGCATCCAGAAGCCACAGAGACAAGCACTTTATCGAGGACTTGACAATCGGGAGGAAGTGGTGGGTAAACTCCGAAGCCTTCA

TACAGATGCCTTGAAGAGACTGGCAGTTAAATGTGAAGACCTCTTCATGGCTGGGCAGAAAGACCAACTCCGCTTTGGAGTAGACAGCTGGTCAGACTTC

AGGCTAACCAGCGACAAACCGTGCTGCGAAGCTGGAGATGCGGTTTACTACACTGCCTCGTATGCAAAAGATCCACTCAGTAACTATGCAGTCAAG - U

NI8782 - ATCTGCAAGAGCAAAGCTAAGGAGTCTCAGCAGTATTACCATAGCCTGGCTGTCCGGCAGAGTCTGCCTGTGCATTTTAACATCCAGCAGG

ATTGTGGCCATTTCCTTGCTGAAGTCCCTAGTCGTCTGCTTCCCTGGGAGGATCCTGATGCTCCTGAAAAGGCAGAGGATGGCACTGAAGACAGCGAAGA

AGAGGGGAAGGCAGAAACTTTGGGGGGAAATCCTGAGCCCTGCTCTGAAACAGAGCCATCCCAGAAAGAGAACCAACGAGTCACAAACAGGAAACAAAGA

AGCCACGTTGTGGTCATCACCAGGGAGGTTCCCCATCTCACTGTGGCCGACTTCGTGCGAGATTCTTTGGCCCATCATGGGAACAGCCCTGACTTGTATG

AGAGGCAAGTGTGTCTGCTGCTCTTACAGCTGTGCTCTGGGCTTGAGCACCTCAAGCCCTACCACGTCACGCACTGCGATCTTCGCCTGGAGAACTTGCT

GCTTGTCCAGCACCAACCTGGGGGAGCTGCCCAGGGCCCTTCTCCTGCAGACCCTTGCCCCACCTTAGCTTGTCCTACAAGGCTCATTGTGAGTAACTTC

TCTCAGGCCAAGCAGAAGAGCCACCTGGTGGACCCCCAGATCCTCCGAGACCAGTCCCGCCTTGCCCCAGAGATCATCACGGCCACCCAGTATAAGAAGT

GTGATGAATTCCAGACGGGCATTCTCATCTATGAGATGCTGCACCTGCCCAACCCTTTTGACGAGAACCCGGAGCTGAAGGAGAAGGAGTACACGCGCAC

AGATCTGCCTCGGATCCCTCTCCGCTCCCCGTACTCCTGGGGTCTACAGCAGCTTGCTAGCTGCCTCCTGAATCCCAACCCTTCTGAGCGCATCCTCATT

TCTGACGCCAAAGGCATCCTCCAATGTCTGCTCTGGGGCCCCCGAGAAGATCTCTTTCAAATCTTCACCACCTCTGCAACCCTCGCACAGAAGAACGCTC

TGCTCCAAAACTGGTTAGACATCAAGCGAACCCTGCTGATGATCAAGTTCGCGGAGAAGTCCCTGGACAGAGAGGGGGGCATCAGCCTGGAGGACTGGCT

TTGTGCTCAGTATCTGGCCTTTGCCACTACAGACTCCCTGAGCTATATTGTAAAAATCCTGCAATACCGTTAATATGGCCCGGGCATTGCTTTTATTGTT

AAATATCTCCACCTTCCTCATGTTACCCTCATGTCCCTGTCCTGGTATCCACTCAGAATTTAAGGAAAGGAAAGAAGCCAACTGCCACCCTTGTCCAGGG

ACATGGGCTCCATTCAGCAAGGTCACCTACAGCTTTCTACAGTGAATGGCTGAGTGTTTCTTTACTGTACAGCAGTTCAGCTGCACAAACATGCAGTCAC

CTTCCCTTGGAGCATTTGTCATCCCAATAGTCTCACAAATGTGGGGTAAAAAGTGAAAAATGCACAGCCATGAAGGAGCAGCTCCCATGGAATGATCTCA

CCAAGCTGCATACACCTCTTCCATAACTCTGAAGCTCGCCTGCATTAACTAGCTAGCAGTACACACATCACCAACCTCAGCTGTCACCCACTAATGCTCT

CACAGCAGATTCCTCTCCCTTGAAGTGACCACCTCTTTCCCTAGAGGACATCCCATTATCCTTCTTGGCTCCGTTGTAGTCACTGGGGACTAGCCTTTGC

TCTGGCATACAGTGAAAGGAGGGGACCCTACATAGAGAGCCACCCGGCAGCCGCAACCCTGCTGCCACTGCTTCACTGTCCTTCACCTTCACCCTGTCCC

GCCTGCTGAAGTTTGGGTTTATCATTCACTTCTTGTGGTGGCCCATTACAAAGCTGACCAAAGGTGGTATCACCGATGCCTCAGCAGGATGAAATATAGT

CCAGAGATTATGAATAGTTGGCAGGATATGAAGAAATAATGTCCTTATGTGTGCAATTCTCCAGGGGCCCTCAGGGAACAGACTTTCAAGTACTGTTCTT

TGATTCCTGTCAGACCTACCCGCATGGCAGCCAGGCCTGGTGGTGTCTGTCTGAGTCAGAGTTTCTTCCCCCACAAGCAGTAATTGGCCAGCTTCCTTCC

GTCAGTAAGCCGGTATTAACTAGTCTGCCAAATGCTGTCGGCAACAGCCCTGAGTGAGATGGTTATCCGTTTAGCGTCACCATCACCTTAGAAAGCTACC

CGAAGCTGGCTATTGGAATGGCCGGAAGACAAGGGGAATGGGAAAGGTCACGAAGATGGCTGACCTGTTCCTCGGAGTGCGAGCCTCTTCCAGAAAGACT

GCCTCCCAGAGTGAGTGGCACGTTGCTCCTAAGACTCTGCAGTGGGTCTGGAGCTCGGCTCACAGGAAGGCTGATGGCTGCAGTGGGTGACTGAGAGTTG

TTCCCCGTGGAGCCCGGGCTCTCCCGTGAATTATGTGCAATTTTTGTATGTATTTTTAAGCTGTATATTACAGTGTTTATGTTGCAACTTTC
Translation
  - UNI19532 -  - UNI29362 - - UNI31105 - MSACNTFTEHVWKPGECKNCFKPKSLHQLPPDSEKTPITHGSGKTNANHSNNHRVRST

GNFRPPVAKKPTIAVKPTMMVADGQSVCGELSIQEHCENKPVILGWNQNKTSLSQKPLNNNSEGDAEGFGSDPQQCANNDSAQKISNNNNGLTEVLKEIA

GLEATPPVRGNETNARETFLGRINDCYKRSLERKIPPSCMTGSMKDSQGKHVILSGSAEVISNEGGRFCYPEFSSGEESEEDVLFSNMEEEHESWDESDE

ELLAMEIRMRGQPRFANFRANTLSPVRFFVSKKWNTIPLRNKSLQRICAVDYDDSYDEILNGYEENSGVSYGQGSVQSTISSDCTSPGSSFTEESRSETA

SSLSQKVCNGGISPGNPGNSKDIAETESNFESPPGNNEEKDESLTSKSSVKVPETHKAVLALRLQEKDGKIAVHTEKPESKASTDIAGQAVTISLVPVEE

QTKPYRVVNLEQPLCKPYTVVDVSAAMASEHLGRPKIKGSSSTPNSPVTSPALTPGQINAHLKKSSAIRYQEVWTSSTSPRQKIPKIELSTGGPGPNVPP

RKNCHKSAPTSPTATNISSKTIPVKSPNLSEIKFNSYNNAGMPPFPIIIHDEPSYARSSKNAIKVPIVINPNAYDNLAIYKSFLGTSGELSVKEKTTSVI

SHTYEEIETESKVSDSTPSKLTDCPQAKGFSNSTERKRGSVAQKVQEFNNCLNRGQSSPQRSYSSTHSSPAKIQRPTQEPAGKTEGAQGSQVPGSSSNST

REKASAVLCQIVASIQPPQTPPEAPQSSPKACSVEELYAVPPDADTTKSIPKNPPVRPKSLFTSQSSGEGEAHQTTESPTAKIQKDPSTKPVTSPPSKLV

TSAQSEPPPPFPPPRSTSSPYHASNLLQRHFTNWTKPTSPTRSTEAESILHSEGSRRAADAKPKRWISFKSFFRRRKTDEEEEKEKEREKGKLVGLDGTV

IHMLPPPPVQRHHWFTEAKGEASEKPAIVFMYRCDPDQGHLSVDQSKAGAEKGRAEEVLLRNSEEKKSSYLPSQIPDKACS - UNI31105 - SRVTH

EVAGELSPRDPRTPAGKQDGTSVTPTLPPPDLEREEEKDDTLDPTDVSPCSATYSNLG - UNI12269 - - UNI31105 - GQSRAAMIPPKHPRH

PKGAVDDAIAFGEKTDQEGLNASQPTPPPLPKKMIRANTEPISKDLQKAMESSLCVMANPTYDIDPNWDASSAGSSISYELKGLDVESYESLERPLHKER

PVPSAANSISSLATLSVKDRFSNSMESLSSRRGLSYRQTRSIQKPQRQALYRGLDNREEVVGKLRSLHTDALKRLAVKCEDLFMAGQKDQLRFGVDSWSD

FRLTSDKPCCEAGDAVYYTASYAKDPLSNYAVK - UNI8782 - ICKSKAKESQQYYHSLAVRQSLPVHFNIQQDCGHFLAEVPSRLLPWEDPDAPEK

AEDGTEDSEEEGKAETLGGNPEPCSETEPSQKENQRVTNRKQRSHVVVITREVPHLTVADFVRDSLAHHGNSPDLYERQVCLLLLQLCSGLEHLKPYHVT

HCDLRLENLLLVQHQPGGAAQGPSPADPCPTLACPTRLIVSNFSQAKQKSHLVDPQILRDQSRLAPEIITATQYKKCDEFQTGILIYEMLHLPNPFDENP

ELKEKEYTRTDLPRIPLRSPYSWGLQQLASCLLNPNPSERILISDAKGILQCLLWGPREDLFQIFTTSATLAQKNALLQNWLDIKRTLLMIKFAEKSLDR

EGGISLEDWLCAQYLAFATTDSLSYIVKILQYR

For any suggestions or comments, please send an email to unitrap@crg.es