Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074365 (Crxos1)
Chromosomal location
Chr 7: 16467966 - 16489358 (+)
Description
Crx opposite strand transcript 1 Gene [Source:MGI (curated);Acc:Crxos1-001]
RefSeq_dna
NM_001033638 
RefSeq_peptide
NP_001028810.1 
UniGene
Mm.259041 Mm.449844 
MGI
MGI:2451355 
Uniprot/SPTREMBL
Q3UEY5 Q3UL53 
Human Ortholog
not available
Omim not available
UniTrap UNI20639
Vector Insertion
Chr 7: 16481607 - 16482752
Public Clones not available
Private Clones OST356038 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28437
Vector Insertion
Chr 7: 16485643 - 16488198
Public Clones not available
Private Clones OST31135 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28880
Vector Insertion
Chr 7: 16488357 - 16489048
Public Clones not available
Private Clones OST17353 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108512
Sequence
GGAGCTCCTATGGTGTCACTGGGAAGCATGGAGGAGGAGCTGGTGGCTGCTGAGAGCAGATGTCCTTGCTATAATTCCTGCCTTGCCCCACCCAAGGACA

GACCTCCACAGATAGCCCCAGGACCTCAGAGATTTCTGGAAAGACATTCTTTTGGCTTTGTTGCTTAG GATTCCCTGCACAGCAGGAGTTGAG GACCT

GTTTACTGGTGGGAGTCTGATATTGAAAGTTACCACTTCATTGTGTAAAG - UNI20639 - CCTCCTGTACCCTGGGTCCCCTTGACCAGAAGTTCA

GTTGGGAGCAGCTTTCAGAGCTGGAAGCATACTTCAAGGTGGAACCATACCCAGACCTCCAGGATCGAAAGATCATGGCCACCAGACTGAAACTGAAAGA

GGAACAAGTTGAG GCTTGGTTCATCCAGAGATCCTTGGAGGAGGAGATGCGGCCCCCCTTGGCCAGGCTGCAGCAGTCTGCCCTGGATGGTACCTCTTC

TCCTTCCCACAAAGCCCTGTGCTGCAGGCCACCAAGCTGGAAGTACAGGCTCATTCCCATCAATCCCCCTGAGTCCTCGACCAGCTGTAAGCACAGTTGC

TGATCCTCCTTCCCCATGGGCCACTCCAACATGTACCACAAAAACTGTTTCCCCAATTCCCCACCCCCTATCACAGGCCTGGCTGCACCAAACTCATCAA

ATGGTGGATGCCTCCCAGAACCCTCAGGGTCAATGTTTGAATACCTGGGTGCCAGGACAGATGACATTGGACAGAAATGGTGCAGAAATGGTGTTGAGTC

TCCACCTAGGGCCTCCACTTGAATGTCCAGGGCCAAACCCCACTGCTGTGGTTCCACTTCTTTTAACAGCCTCCCCTCAAAAGTGGCCTCTCCTTCAGGA

TAGCTATCAACTCAATGTGCAGCACAGTATCACACTGACTTCTTGCCTCCTTTCCCAAGGCATGGTTACAGGCTGACATATACTGCCAGAACAACCACTT

CCCAAGAGATTGACTGGCTAACAAGGCTGGATTTTTATTCCCTCTGACCTTGATCACTCATCTTGTACCAATGAGTAACTTATTGGTTTGTGTGTGATTG

GATTGTATTTTTTTTTTGGTCTATTGGTGTTTCTGAGGCACCTGCTTGGGGATTTAGATCTTGGAGTGGCTCATTGATAACATGAAATTGTTGACAAATT

GGTTTTTTAAAAAAGCTTGTGTTGTTTTCACAAAAAAATACTTTGTGTGGAAGCTGGCTGTTGTATAGAAGTCAGGACAAAGGACAGCATAGGATTAGGG

TCTCCTGGTGCTGGAGTGGAGCTTAGCTCTTCAGGCTTCCTGCCAAAGGTCTTTCATCACAGTCGCCTCAATAGCTAGGTTTCTTATTTGTGCGTGATGC

TCTTTGAGGTAAAAGTTTCACTGTGATACTTCTAGCTGGCCTGGACTTTGCACCATTAACCTTGAATCTGAATTAACTCCAGATGTGCCTAGCTCTGCCT

CAAAGTGCTGGTATATAAGGCTCATACCACCACTGTGCTATCCCTGATCCCAAAGTCTTTAAGCTTAGACTTGAAGTTGAGGAAACTCCCTCCCGAGAGT

TTGATTAACACCTGGACATAATGGAAAATCAGGAATTTATTGTATATGTATGGACTACACTAGTGAGACCGGTTACAGCAGGACTAGAAGCCTCTGCATG

GACCATCCCTGCCTATGGAGATCAGGCTGGCCTTGAACTCACAGAACTCTGCCTGCCTTTGCCTCTTGAGTAATGGAAGTGAAGGTCTGCTCCGACATGC

GCAGGCTGCAGATGACATTCCTTGGGTTTGGTGGAAGTTACTGTTGTGATCATACTTTAGAAAAGGTGAAGGATTTATATTGTTATAGGTATGGCTACAC

TGCGGCCCTGGACAGCCCAGGATGACTTTGCTTTAACCACACACGGTCTCCAAATGCTAACAAAGCAACCTCATTGTTTGGGTTTTGTTATTAAAACAGG

GTCTCTAAGTAACACTGGCTGCTCTAGAATGCTCTATGCAGACCAGGTTGGCCCTCAAATCTCAGAGATCCACCTGTCTTCTTCCCACCACACCCCCAGT

GCTCTCATCAAAGGCATGGGCCACCTGACTTGGTTCCCTGTAGAATCCTCCAAACAGACAAGGGTGACATGGAAATTTATATTCCTGATAACTTCAGTTC

CTGAGACAGGGATTGATGTTGTCAATTCAGTCAGGTGATGTTTCAATAAATTATTCAATGTCT
Translation
   - UNI20639 -  MVPLLLPTKPCAAGHQAGSTGSFPSIPLSPRPAVSTVADPPSPWATPTCTTKTVSPIPHPLSQAWLHQTHQMVDASQNPQGQC

LNTWVPGQMTLDRNGAEMVLSLHLGPPLECPGPNPTAVVPLLLTASPQKWPLLQDSYQLNVQHSITLTSCLLSQGMVTG
Transcript ENSMUST00000098801
Sequence
GGCTACAGGTTGGAGGGTCCCTGCTCAGTGCGCCCAACTTGAAGCTCAGTTTGAATCCTAAATCCTTAGAGCATACCTTCAATCACAACTGAAGTGAGCT

ACAGGCGAAATGGAAGCATCTCCACGTTCCCTGA - UNI20639 - CCTCCTGTACCCTGGGTCCCCTTGACCAGAAGTTCAGTTGGGAGCAGCTTTC

AGAGCTGGAAGCATACTTCAAGGTGGAACCATACCCAGACCTCCAGGATCGAAAGATCATGGCCACCAGACTGAAACTGAAAGAGGAACAAGTTGAG GC

TTGGTTCATCCAGAGATCCTTGGAGGAGGAGATGCGGCCCCCCTTGGCCAGGCTGCAGCAGTCTGCCCTGGATGGTACCTCTTCTCCTTCCCACAAAGCC

CTGTGCTGCAGGCCACCAAGCTGGAAGTACAGGCTCATTCCCATCAATCCCCCTGAGTCCTCGACCAGCT - UNI28437 - GCTTAAAGGATAGCAA

AACTGTATTAATTTCAAAGACGGAGTTGACCGATGAGCAGTTCCAGAAGCTAAGAAAGCACTTCGAGACAGACCGTTGCCCTAATGAGGAAACTCTGCAG

GCCTTCGCTGAGGAACTCAAACTACGGAAAGACCTCATCAGA - UNI28880 - TCCTGGTTCATCACTCAGCGTCACAGAATGAGGGGGTACAGACG

GTTATTTATGCGCTACTACAGGGATTGGAAAACGTCCCGTGAGTACTCTACAACAAGAAGTTTCGACAGGCAGAAGAACTCCAAGGAGTGCTCTCAGAAT

GACCCTGGACTCCCCGAAGCATTGGAAGCCTTGAAGAGGCTCAAGCTCTCTTCTGGGTACCAAAGCAGAGATGGCATGTCACAAGATTTCTGACTTTTCA

ACTTCTTGGTGGGGGCAGGCGTCTGTCTATGGGAGAAGGTACATTAATAATAAAGCGTGCATTCAT
Translation
MEASPRSLT - UNI20639 - TSCTLGPLDQKFSWEQLSELEAYFKVEPYPDLQDRKIMATRLKLKEEQVE AWFIQRSLEEEMRPPLARLQQSALDG

TSSPSHKALCCRPPSWKYRLIPINPPESSTSC - UNI28437 - CLKDSKTVLISKTELTDEQFQKLRKHFETDRCPNEETLQAFAEELKLRKDLIR 

- UNI28880 - SWFITQRHRMRGYRRLFMRYYRDWKTSREYSTTRSFDRQKNSKECSQNDPGLPEALEALKRLKLSSGYQSRDGMSQDF

For any suggestions or comments, please send an email to unitrap@crg.es