Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074405 (6430526N21Rik)
Chromosomal location
Chr 7: 4971978 - 4984825 (+)
Description
RIKEN cDNA 6430526N21 gene Gene [Source:MGI Symbol;Acc:MGI:2442656]
RefSeq_dna
NM_001033383 
RefSeq_peptide
NP_001028555.1 
UniGene
Mm.86607 Mm.428047 
MGI
MGI:2442656 
Uniprot/SPTREMBL
Q1LZJ0 Q3U3I9 
Human Ortholog
not available
Omim not available
UniTrap UNI29495
Vector Insertion
Chr 7: 4972258 - 4981339
Public Clones (sanger) D187B05 (ggtc) E038A09 (ggtc) D110G12 (ggtc) P137B03 (ggtc)
IST14047B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29825
Vector Insertion
Chr 7: 4981740 - 4982764
Public Clones E057D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17296
Vector Insertion
Chr 7: 4983810 - 4984364
Public Clones CMHD-GT_513B11-3 (cmhd) CMHD-GT_457B1-3 (cmhd)
Private Clones OST445761 (lexicon) OST434076 (lexicon) OST323050 (lexicon) OST308011 (lexicon)
OST285864 (lexicon) OST285528 (lexicon) OST235506 (lexicon) OST234361 (lexicon)
OST224604 (lexicon) OST216643 (lexicon) OST207737 (lexicon) OST189197 (lexicon)
OST171176 (lexicon) OST153153 (lexicon) OST145584 (lexicon) OST133655 (lexicon)
OST111868 (lexicon) OST106000 (lexicon) OST90792 (lexicon) OST57213 (lexicon)
OST54170 (lexicon) OST33403 (lexicon) OST9519 (lexicon) OST7907 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086350
Sequence
GTGCACTCCGGGGAACGACCATACGAATGCGGCATCTGTGGCCGCACCTACAACCATGTCTCCAGTCTCATCCGCCACCGACGCTGCCACAA TCCCTCT

GCTGGAAGGTCTTCAAGAAGCCTAGCCACCTCCACCAGCACCAGATCATCCACACGG - UNI29825 - GCTGCCCCGGAGCGCCTTCT TCTTCTGA

TGGCGGCAGCAGCGGCGGCGGCACCGA AGCAGCGGCCCTACCGGTGCGGCGTGTGCGGTAGAGGCTTCCTGCGCTCCTGGTACCTGCGGCAGCACCGCG

TGGTGCACACGGGCGAGCGCGCCTTCAAGTGCGGCGTGTGCGCCAAGCACTTCGCGCAGTCTTCTAGCCTAGCGGAGCACCGGCGGCTGCACGCTGTGGC

TCGGCCTCAGCGCTGCGGCGCCTGCGGCAAGACCTTCCGCTACCGCTCCAACCTGCTGGAGCATCAGCGGCTGCAC
Translation
VHSGERPYECGICGRTYNHVSSLIRHRRCHN NPSAGRSSRSLATSTSTRSSTR - UNI29825 - AAPERLL LLLMAAAAAAAPK KQRPYRCGVC

GRGFLRSWYLRQHRVVHTGERAFKCGVCAKHFAQSSSLAEHRRLHAVARPQRCGACGKTFRYRSNLLEHQRLH
Transcript ENSMUST00000076251
Sequence
GCATGCGCACTAGGCCCCGTTCGCCCACCGGAAGCAGCCTTGGCTGTTCCCCTCCCGTGTCTAGTGCCGGCGTAATTTCCCTTACCCGTTCCTCCGCCAC

CATCCTCCACGCCGGCGCTTGGGGGAACGGGCGCGACTTCCGCTTCCGGGCAGGAGGCGCGGGGCTGGTGGGGAGTTGAGGGGGAAGGGGCGGCACTTCC

GGTTGGGCCCTCGGGTCTCCCCGGAGCGGCGGCACCTCCTCCGCCTCCTCAGCCTCCTCCCGGCGGAGACCCCAGCGCCG - UNI29495 - GGTCTC

CCTTCTTTCCACCGACCAGAGATGGAGGCAAACCAGGCAGGCAGCGGTGCCGGGGGTGGCGGGAGCAGCGGCATCGGGGGCGAGGACGGGGTCCACTTCC

AGAGTTACCCATTTGACTTCCTGGAATTCCTCAACCACCAGCGCTTTGAGCCCATGGAGCTATACGGGGAACACGCCAAGGCAGTGGCAGCCCTGCCCTG

TACCCCGGGGCCCCCGCCCCAGCCCCCACCCCAGCCTCCTCCACCCCAATATGACTACCCACCCCAGTCCAGTTTCAAACCCAAGGCGGAGGCTCCTTCC

TCATCTTCATCATCATCTTCATCATCATCTTCCTCATCTTCGTCTTCCTCATCCTCTTCCCAAGCCAAGAAGATGGATCCGCCTTTGCCACCCACCTTCG

GGGCACCTCCCCCTCCACTCTTTGATGCTGCCTTCCCTGCTCCGCAATGGGGAATAGTCGACCTCTCTGGACACCAGCACCTGTTCGGGAACCTGAAACG

TGGTGGGCCCACCCCTGGGCCTGGAGTAGCATCAGGACTGGGCACTCCCACTGGGACCCCAGGGCCACTTACCACACCCTCGCAGACCCCGCCTGGGCCC

GCAGTAGGGGCAGCCTGCGACCCAACCAAGGACGACAAGGGCTATTTCCGAAGGCTGAAGTACCTGATGGAGCGACGCTTCCCGTGTGGTGTTTGCCAGA

AGTCCTTCAAACAGTCCTCACATCTGGTCCAGCACATGTTAGTGCACTCCGGGGAACGACCATACGAATGCGGCATCTGTGGCCGCACCTACAACCATGT

CTCCAGTCTCATCCGCCACCGACGCTGCCACAAGGATGTGCCACCAACACCAACTGGAGGTACGCCACAGCCTGGGCCCGCACTCCCTTCACTGGGCCTC

CCGGTATCCACAGCCAGTGCCACAGCCAGCTCTGACCCCGCCGCAGTGTCCTCTGGCCCCTCAGCCACCCCTGCAACGCCTGCCACCTCCACTGATGGGA

ACACCACCCCTGCTGCCCCACCCGGGGTGGCCATGCCTCCCTCTGCCACTACTGGCGGTGATGGCCCATTTGCCTGCTCCCTCTGCTGGAAGGTCTTCAA

GAAGCCTAGCCACCTCCACCAGCACCAGATCATCCACACGGGTGAGAAACCCTTCTCCTGCTCCGTGTGCAGCAAAAGCTTCAACCGGAGGGAGAGCCTC

AAACGTCACGTGAAAACGCACTCGGCCGACTTGCTGCGCCTGCCCTGTGGCATCTGTGGCAAGGTCTTCCGCGATGCTTCCTACCTCCTCAAGCACCAGG

CAGCCCACGCAGCGGCCGGGACTCCGCGGCCGGTGTACCCCTGCGACCTGTGCGGGAAAACATACTCCGCACCGCAGAGCCTGCTGCGACACAAGGCTGC

CCACGCACCACCTGTGGCCACGGAGCCGGCAAAGGACGGGGCTGCCTCGGTCCCACAGCCACCACCTCCCTTCCCCCCAGGTCCTTACCTCCTGCCCGCG

GACCCATCCACTACCGACGAGAAAGCCACAGCGGCCGCAGCGGCTGTGGTGTATGGTGCGGTGCCTGTCCCACTTCTCAGCGCGCATCCGCTGCTGCTCG

GCGGTGCGGGGAATGGTGGTGCTGGAGGCCCGGGCGCAGGCGGCCCCAGCAAGACGTTCTGCTGTGGCATCTGTGGGCGCGCGTTTGGGCGCCGCGAGAC

CCTGAAGCGCCACGAGCGCATCCACACCGGCGAGAAGCCCCACCAGTGCCCGGTGTGCGGGAAGCGTTTCCGGGAGTCCTTCCATCTGAGCAAGCACCAC

GTGGTGCACACCCGAGAGCGGCCCTACAAGTGCGAGTTGTGCGGCAAGGTCTTCGGCTACCCGCAGAGCCTCACACGCCACCGCCAGGTGCATCGGCTCC

AATTGCCCTGCGCCCTGGCCGGAGCCACAGGCCTCGCCACCGGCCAGGGGACCACTGGGGCCTGTGGACCCGGAGCTGCAGGCACTTCAGGTGGGCCGGC

CGACCTGAGCTATGCCTGCTCAGACTGCGGGGAGCACTTCCCGGATCTCTTCCACGTCATGAGTCACAAGGAAGCTCACATGTCAGAGAAGCCGTATGGC

TGTGACGCCTGCGGCAAGACGTTCGGTTTCATCGAGAACCTCATGTGGCACAAGCTGGTTCACCAGGCTGCCCCGGAGCGCCTTCTAGCGCCAACACCCA

GTGGCCCCCAGTCTTCTGATGGCGGCAGCAGCGGCGGCGGCACCGATGCATCCAGCGTGCTGGACAACGGACTGGCCGGAGAGGTGGGGACGGCTGTGGC

AGCGCTGGCTGGGGTGTCTGGGGGCAGCGAGGATGCGGGTGGGGCGACGGTGGCCGGATCGGGTGGCGGGACCAGTTCAGGCGCTGAGCGCTTCAGCTGT

GCCACATGCGGCCAAAGCTTCAAGCATTTCCTAGGCCTGGTGACTCATAAGTATGTGCACCTGGTGCGCCGGACCCTTGGTTGCGGCCTCTGCGGTCAGA

GCTTTGCGGGCGCGTACGATCTGCTCCTGCACCGCCGAAGCCACCGGCAGAAACGGGGTTTCCGCTGCCCAGTGTGTGGGAAGCGCTTCTGGGAGGCGGC

CCTACTGATGCGCCACCAGCGCTGTCACACAGAGCAGCGGCCCTACCGGTGCGGCGTGTGCGGTAGAGGCTTCCTGCGCTCCTGGTACCTGCGGCAGCAC

CGCGTGGTGCACACGGGCGAGCGCGCCTTCAAGTGCGGCGTGTGCGCCAAGCACTTCGCGCAGTCTTCTAGCCTAGCGGAGCACCGGCGGCTGCACGCTG

TGGCTCGGCCTCAGCGCTGCGGCGCCTGCGGCAAGACCTTCCGCTACCGCTCCAACCTGCTGGAGCATCAGCGGCTGCACCTGGGCGAGCGCGCCTACCG

CTGTGAGCACTGCGGCAAGGGCTTCTTCTACCTGAGCTCCGTGTTACGCCATCAGCGAGCCCACGAGCCCCCGCGGCCCGAGCTGCGCTGTCCTGCCTGT

CTCAAAGCCTTCAAGGATCCTGGCTACTTCCGGAAGCATCTGGCTGCCCATCAGGGCGGCAGGCCCTTCCGCTGCTCCTCCTGCGGTGAGGGCTTCGCCA

ACACCTATGGTCTGAAGAAACACCGCCTGATGCACAAGGCTGAGGGTCTTGGGATGCCCGGAACAGGGGGAAGCGCCTTGGCCGGAAAGGATCCCTGACC

AGGGTGTTTCA - UNI17296 - GTTGAGTGAGGATTTGCCATGTCCCAGGCATTAGCCTGAGTGAAACAGGGAAGTCGCCCTCTCAGGAACTGATTT

GAGACCCCGAGACTCCCTTCCATGATGCTCTCAGCCACCATGGAAACACCGGAAGCCTTCTGTCTGCCAAGCCCTGACCTGGGCGCTAGGGAGACTGATG

AATTGATCGGACATGACATTCACACTCCAGTAGGCTGGGAGAGCATACCTGAGGAACTTAACACAGTCTGCAGACTTACTGGAGACGGTCTCATGTAGTC

TAGGCTAGCTATGGACTTGCTTTGTAGGTACAGATAGGCTTGATTTTCCCCCATTTTTGAGACATGGTCTCTCTATGTAACCCTTGGCTCTCCTGGAATT

CTCTGTGGACTAGGCTGGTTTTGAATTTACAGAAATCCACCTGCCTCTCTGCCTCTCTGGTGCTGAGATTAAAGGTGTGCACCACC
Translation
 - UNI29495 - MEANQAGSGAGGGGSSGIGGEDGVHFQSYPFDFLEFLNHQRFEPMELYGEHAKAVAALPCTPGPPPQPPPQPPPPQYDYPPQSSFK

PKAEAPSSSSSSSSSSSSSSSSSSSSSQAKKMDPPLPPTFGAPPPPLFDAAFPAPQWGIVDLSGHQHLFGNLKRGGPTPGPGVASGLGTPTGTPGPLTTP

SQTPPGPAVGAACDPTKDDKGYFRRLKYLMERRFPCGVCQKSFKQSSHLVQHMLVHSGERPYECGICGRTYNHVSSLIRHRRCHKDVPPTPTGGTPQPGP

ALPSLGLPVSTASATASSDPAAVSSGPSATPATPATSTDGNTTPAAPPGVAMPPSATTGGDGPFACSLCWKVFKKPSHLHQHQIIHTGEKPFSCSVCSKS

FNRRESLKRHVKTHSADLLRLPCGICGKVFRDASYLLKHQAAHAAAGTPRPVYPCDLCGKTYSAPQSLLRHKAAHAPPVATEPAKDGAASVPQPPPPFPP

GPYLLPADPSTTDEKATAAAAAVVYGAVPVPLLSAHPLLLGGAGNGGAGGPGAGGPSKTFCCGICGRAFGRRETLKRHERIHTGEKPHQCPVCGKRFRES

FHLSKHHVVHTRERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGATGLATGQGTTGACGPGAAGTSGGPADLSYACSDCGEHFPDLFHVMSHKEAH

MSEKPYGCDACGKTFGFIENLMWHKLVHQAAPERLLAPTPSGPQSSDGGSSGGGTDASSVLDNGLAGEVGTAVAALAGVSGGSEDAGGATVAGSGGGTSS

GAERFSCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHRRSHRQKRGFRCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVCGRGFLR

SWYLRQHRVVHTGERAFKCGVCAKHFAQSSSLAEHRRLHAVARPQRCGACGKTFRYRSNLLEHQRLHLGERAYRCEHCGKGFFYLSSVLRHQRAHEPPRP

ELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCSSCGEGFANTYGLKKHRLMHKAEGLGMPGTGGSALAGKDP - UNI17296 - 
Transcript ENSMUST00000085427
Sequence
ACTTCCGGTTGGGCCCTCGGGTCTCCCCGGAGCGGCGGCACCTCCTCCGCCTCCTCAGCCTCCTCCCGGCGGAGACCCCAGCGCCG - UNI29495 - 

GGTCTCCCTTCTTTCCACCGACCAGAGATGGAGGCAAACCAGGCAGGCAGCGGTGCCGGGGGTGGCGGGAGCAGCGGCATCGGGGGCGAGGACGGGGTCC

ACTTCCAGAGTTACCCATTTGACTTCCTGGAATTCCTCAACCACCAGCGCTTTGAGCCCATGGAGCTATACGGGGAACACGCCAAGGCAGTGGCAGCCCT

GCCCTGTACCCCGGGGCCCCCGCCCCAGCCCCCACCCCAGCCTCCTCCACCCCAATATGACTACCCACCCCAGTCCAGTTTCAAACCCAAGGCGGAGGCT

CCTTCCTCATCTTCATCATCATCTTCATCATCATCTTCCTCATCTTCGTCTTCCTCATCCTCTTCCCAAGCCAAGAAGATGGATCCGCCTTTGCCACCCA

CCTTCGGGGCACCTCCCCCTCCACTCTTTGATGCTGCCTTCCCTGCTCCGCAATGGGGAATAGTCGACCTCTCTGGACACCAGCACCTGTTCGGGAACCT

GAAACGTGGTGGGCCCACCCCTGGGCCTGGAGTAGCATCAGGACTGGGCACTCCCACTGGGACCCCAGGGCCACTTACCACACCCTCGCAGACCCCGCCT

GGGCCCGCAGTAGGGGCAGCCTGCGACCCAACCAAGGACGACAAGGGCTATTTCCGAAGGCTGAAGTACCTGATGGAGCGACGCTTCCCGTGTGGTGTTT

GCCAGAAGTCCTTCAAACAGTCCTCACATCTGGTCCAGCACATGTTAGTGCACTCCGGGGAACGACCATACGAATGCGGCATCTGTGGCCGCACCTACAA

CCATGTCTCCAGTCTCATCCGCCACCGACGCTGCCACAAGGATGTGCCACCAACACCAACTGGAGGTACGCCACAGCCTGGGCCCGCACTCCCTTCACTG

GGCCTCCCGGTATCCACAGCCAGTGCCACAGCCAGCTCTGACCCCGCCGCAGTGTCCTCTGGCCCCTCAGCCACCCCTGCAACGCCTGCCACCTCCACTG

ATGGGAACACCACCCCTGCTGCCCCACCCGGGGTGGCCATGCCTCCCTCTGCCACTACTGGCGGTGATGGCCCATTTGCCTGCTCCCTCTGCTGGAAGGT

CTTCAAGAAGCCTAGCCACCTCCACCAGCACCAGATCATCCACACGGGTGAGAAACCCTTCTCCTGCTCCGTGTGCAGCAAAAGCTTCAACCGGAGGGAG

AGCCTCAAACGTCACGTGAAAACGCACTCGGCCGACTTGCTGCGCCTGCCCTGTGGCATCTGTGGCAAGGTCTTCCGCGATGCTTCCTACCTCCTCAAGC

ACCAGGCAGCCCACGCAGCGGCCGGGACTCCGCGGCCGGTGTACCCCTGCGACCTGTGCGGGAAAACATACTCCGCACCGCAGAGCCTGCTGCGACACAA

GGCTGCCCACGCACCACCTGTGGCCACGGAGCCGGCAAAGGACGGGGCTGCCTCGGTCCCACAGCCACCACCTCCCTTCCCCCCAGGTCCTTACCTCCTG

CCCGCGGACCCATCCACTACCGACGAGAAAGCCACAGCGGCCGCAGCGGCTGTGGTGTATGGTGCGGTGCCTGTCCCACTTCTCAGCGCGCATCCGCTGC

TGCTCGGCGGTGCGGGGAATGGTGGTGCTGGAGGCCCGGGCGCAGGCGGCCCCAGCAAGACGTTCTGCTGTGGCATCTGTGGGCGCGCGTTTGGGCGCCG

CGAGACCCTGAAGCGCCACGAGCGCATCCACACCGGCGAGAAGCCCCACCAGTGCCCGGTGTGCGGGAAGCGTTTCCGGGAGTCCTTCCATCTGAGCAAG

CACCACGTGGTGCACACCCGAGAGCGGCCCTACAAGTGCGAGTTGTGCGGCAAGGTCTTCGGCTACCCGCAGAGCCTCACACGCCACCGCCAGGTGCATC

GGCTCCAATTGCCCTGCGCCCTGGCCGGAGCCACAGGCCTCGCCACCGGCCAGGGGACCACTGGGGCCTGTGGACCCGGAGCTGCAGGCACTTCAGGTGG

GCCGGCCGACCTGAGCTATGCCTGCTCAGACTGCGGGGAGCACTTCCCGGATCTCTTCCACGTCATGAGTCACAAGGAAGCTCACATGTCAGAGAAGCCG

TATGGCTGTGACGCCTGCGGCAAGACGTTCGGTTTCATCGAGAACCTCATGTGGCACAAGCTGGTTCACCAGGCTGCCCCGGAGCGCCTTCTAGCGCCAA

CACCCAGTGGCCCCCAGTCTTCTGATGGCGGCAGCAGCGGCGGCGGCACCGATGCATCCAGCGTGCTGGACAACGGACTGGCCGGAGAG - UNI17296

 - GTTGAGTGAGGATTTGCCATGTCCCAGGCATTAGCCTGAGTGAAACAGGGAAGTCGCCCTCTCAGGAACTGATTTGAGACCCCGAGACTCCCTTCCA

TGATGCTCTCAGCCACCATGGAAACACCGGAAGCCTTCTGTCTGCCAAGCCCTGACCTGGGCGCTAGGGAGACTGATGAATTGATCGGACATGACATTCA

CACTCCAGTAGGCTGGGAGAGCATACCTGAGGAACTTAACACAGTCTGCAGACTTACTGGAGACGGTCTCATGTAGTCTAGGCTAGCTATGGACTTGCTT

TGTAGGTACAGATAGGCTTGATTTTCCCCCATTTTTGAGACATGGTCTCTCTATGTAACCCTTGGCTCTCCTGGAATTC
Translation
 - UNI29495 - MEANQAGSGAGGGGSSGIGGEDGVHFQSYPFDFLEFLNHQRFEPMELYGEHAKAVAALPCTPGPPPQPPPQPPPPQYDYPPQSSFK

PKAEAPSSSSSSSSSSSSSSSSSSSSSQAKKMDPPLPPTFGAPPPPLFDAAFPAPQWGIVDLSGHQHLFGNLKRGGPTPGPGVASGLGTPTGTPGPLTTP

SQTPPGPAVGAACDPTKDDKGYFRRLKYLMERRFPCGVCQKSFKQSSHLVQHMLVHSGERPYECGICGRTYNHVSSLIRHRRCHKDVPPTPTGGTPQPGP

ALPSLGLPVSTASATASSDPAAVSSGPSATPATPATSTDGNTTPAAPPGVAMPPSATTGGDGPFACSLCWKVFKKPSHLHQHQIIHTGEKPFSCSVCSKS

FNRRESLKRHVKTHSADLLRLPCGICGKVFRDASYLLKHQAAHAAAGTPRPVYPCDLCGKTYSAPQSLLRHKAAHAPPVATEPAKDGAASVPQPPPPFPP

GPYLLPADPSTTDEKATAAAAAVVYGAVPVPLLSAHPLLLGGAGNGGAGGPGAGGPSKTFCCGICGRAFGRRETLKRHERIHTGEKPHQCPVCGKRFRES

FHLSKHHVVHTRERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGATGLATGQGTTGACGPGAAGTSGGPADLSYACSDCGEHFPDLFHVMSHKEAH

MSEKPYGCDACGKTFGFIENLMWHKLVHQAAPERLLAPTPSGPQSSDGGSSGGGTDASSVLDNGLAGE - UNI17296 - VE

For any suggestions or comments, please send an email to unitrap@crg.es