Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074415 (2610203C20Rik)
Chromosomal location
Chr 9: 41389111 - 41398397 (+)
Description
RIKEN cDNA 2610203C20 gene Gene [Source:MGI Symbol;Acc:MGI:1917705]
Human Ortholog
not available
Omim not available
UniTrap UNI36085
Vector Insertion
Chr 9: 41389486 - 41398302
Public Clones IST15106H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098868
Sequence
ATGCTAGAGAAAGAAGAAGAAAAAGAAAAAGAATTTTTTTTTTCCGAGCAGTCCTTGGGAGATTTTCTCGTTCTCTCTCGATTTATTTATTTATTTCTAT

TTTTTTTAACCGACTATTTTCCAAATTCGATCAGCCCCAGCCCC CCTCCACTCCCACCCAACAGCCTTCCCCCCACCCCCCACCCCCGGTCAAAGCATA

AACCACAGAGTTACGGTCTTCTTTGGATTTTGGAGTATCGCTTCCTGCCCCCGCCTTCCCTCCCCGCCCCATTCTCTGTCCTATTGAACACCTCGCCCAG

CCTAGAGCTCACATTCTCCCCCTGCTCCCGATGGCGCTCCTGGAAGCTCTGCAACTATGCTCCACTTCAAATGG - UNI36085 - CTGGTCCTATAG

CCCCCTTTCTCAGTAATGTCTCCCCAGTGAAAGGAAAAAGACTGCAGAGGCTTCAGACTGACGGACGCTCATGCCAACTGTGA
Translation
MLEKEEEKEKEFFFSEQSLGDFLVLSRFIYLFLFFLTDYFPNSISPSP PPLPPNSLPPTPHPRSKHKPQSYGLLWILEYRFLPPPSLPAPFSVLLNTSP

SLELTFSPCSRWRSWKLCNYAPLQMA - UNI36085 - AGPIAPFLSNVSPVKGKRLQRLQTDGRSCQL

For any suggestions or comments, please send an email to unitrap@crg.es