Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074513 (Arfip1)
Chromosomal location
Chr 3: 84299985 - 84386547 (-)
Description
ADP-ribosylation factor interacting protein 1 Gene [Source:MGI Symbol;Acc:MGI:1277120]
RefSeq_dna
NM_001081093 
RefSeq_peptide
NP_001074562.1 
UniGene
Mm.475954 
MGI
MGI:1277120 
Uniprot/SPTREMBL
A2RSX9 Q3TVE1 
Human Ortholog
ENSG00000164144 (ARFIP1)
Omim not available
UniTrap UNI16295
Vector Insertion
Chr 3: 84351958 - 84386335
Public Clones IST14210A5 (tigm) IST14441F12 (tigm) IST11406D9 (tigm)
Private Clones OST463870 (lexicon) OST170394 (lexicon) OST145227 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2208
Vector Insertion
Chr 3: 84338618 - 84351855
Public Clones XR0819 (sanger) XR0403 (sanger) IST11041E6 (tigm)
Private Clones OST216044 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2680
Vector Insertion
Chr 3: 84319713 - 84323403
Public Clones AL0508 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27575
Vector Insertion
Chr 3: 84313905 - 84319554
Public Clones not available
Private Clones OST56238 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6287
Vector Insertion
Chr 3: 84301814 - 84313729
Public Clones CSF008 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098990
Sequence
GAGGTCGCGGGTGCAAGTGTCCTCGGCGGTTGGTTGCCCGGAGCCTGTGACAGCTGTAGCTGCTCCCCGCCCCCGAGGCGTGGGGGAGGAGACGAAGGAA

AAGCTCCCGGTTGCGCTTCCGGTCCCTTCTCCCTCTGGCCGACGTGATTCCCGAGGGCTGCGACCGGGAGAGCCCGCGACGGAGCGCTGCCGGCTTCCCC

GCTGACAGACAG - UNI16295 - GTGTCTGCCATGGCTCAAGAATCTCCCAAAAACTCTGCAGCAGAAATCCCAGTAACTAGTAATGGAGAAGTTGA

CGATGCTCATGAGCATGGCTACAATAGG - UNI2208 - GATTTGAAGCATTCATTACCATCTGGACTTGGACTCTCAGAAACTCAGATCACATCTCA

TGGCTTTGACAGTACCAAAGAGGGGGTTACTGAAGCAGGAGCACCCCAAG GTGGCCAAAGAACACACACAAAAGGAGGACCAGTTATTCTAGCAGATGA

AATAAAAAATCCTGCAATGGAGAAGTTAGAACTTGTTAGAAAATGGAGTCTCAACACATATAAG TGTACCCGGCAAATTATATCTGAGAAACTAGGCCG

TGGCTCAAGAACTGTGGACCTTGAACTTGAAGCTCAGATTGATATATTAAGAGATAATAAGAAAAAATATGAAAACATTCTGAAACTGGCTCAGACCTTG

TCGACGCAGCTTTTCCAGATGGTGCACACCCAAAAGCAACTCGGAGATGCCTTTGCTGACCTGAGTTTGAAGTCTCTAGAGCTCCAT - UNI2680 - 

GAAGAATTTGGCTATAATGCAGATACACAGAAGCTGCTGGCTAAAAATGGAGAGACTCTTCTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACCT

TGGTGAATAAAACAATTGAAGATACATTAATGACTGTAAAACAGTATGAAAATGCCAG - UNI27575 - AGTTGAATATGATGCGTACCGCACTGAT

TTGGAAGAACTGAACCTTGGGCCACGTGATGCAAACACTCTGCCAAAAATTGAGCAGTCGCAGCATCTGTTCCAAATACATAAGGAAAAATATGATAAAA

TGCGCAGTGATGTTTCTGTCAAATTGAAATTTCTCGAGGAAAATAAG - UNI6287 - GTCAAAGTGCTACGCAACCAACTGGTCCTCTTCCACAGCG

CAGTTGCTGCCTACTTCGCCGGGAATCAGAAGCAGCTTGAACTGACACTTAAGCAGTTCCATGTCAGATTGAAAACCCCTGGAGTGGACGCTCCATCTTG

GCTCGAAGAACAGTAAACTCCCCTGGAAAAGAAGGAACGGTGTATTGTTAAACAACTAATGAACTAGTAAGAGTTAAGTAGTGTTGGGGAGGCCGTGGAG

TGACCACCATTGTAGTGGCTCTTGCACAGATAGCTTTTATTTTTCCCTTTTCATACATAACAATTGAGCTGTTAAATTTGATGGGAAGGTAGGTGATTTT

TTATGTAAACATAATTTCTATAATTCTAAACATAATAATTTTCCTTTTTGAGAAATCCTTTTTGTATTGTGAAGGTTATGGCTATTTCTGTAGGTTGAAA

TATTTAATATAGATTTGCACTGACAAGATAAAAATTCAAGGCTTTTTTTGGTCCCAGAAATGAGGGCCAGCTATAGTTTTCCAAGGGAGGTTTACATGAT

TTGTATCAATGTCAGATATTTTATATATGAATATATTCAACATCTTTAAGAAGTTCATGTTTGTGTATTATCTTAAAGAAAAAAGAAGCTGTTTCACAGA

ATAAGTTTTATGATGTCCTGCAGTGTCACACAAGGGGCAGCCGAATAAGTGACTGACTGGCCCATAGCTTGTTGCAGATACACTTTAAAAATTAATCTGT

AACACTGTAATTTTGTTTAGATATTTATAAAGGTCCGGGAATCACACAGTCATATTTTATGACGTGTTTAAACTTATGAATTTGACAGTTGTGCTAGCAG

TTTTGATTTATAATGAAATCTGCTTAAGAGGGATAGGTTTTGTTATTTTGTTTTGGGTTTTTTTTTAACATGTGGACATGGAAATTATTAGCAGTTTCTA

GAGCAGAAATTTATAGATTAGAAAGCTAGTTTGGGAGTAAATTCCGTTTTGATAGAAGAGAATTTCCAGACTGTGTTCATTGGCTTCCATGCGTGACTAT

ACCAGTTAAGCCTTAAATCACAGATACGTGCCTTCTCCGATGCAGTAATTCTTGCCCAACCATTGTACATACATGAGGAAACCCCTATGGATAACATTTG

ATTCATCTGTAACGTTGGGATATTTTGTCCTCATAAAACCACACTTGAGGTGGATGGTGAAAACAACCTTTGAATTTTATATTTTGTTTCTCTTGATTCC

TCTTGAAGAAGGGGGTGATGGGAAAGTTTTCCCCCTTGGGTAATGAAAAGGTTGTGTAAAGTGTGTGGAGGTCGTAGGACGGAAAATCCAGTGCTGGGTT

ACTTGTGTAGCACTGTGGTCTTGTGTATGCGGTTGGCTTGTCTACTGTGTGGTTCCTCAGCGATGTAATCTTGTTTAAATGTAAAGTTCCCTTGATTTTG

TCATACATATAAATGAGTATTTTCAGAGATCCCACTTCACCTGTTATTTCTATTGTGTTGAAATGAAGTACTTAAAATTACTGTTCTCCGTGAACTCTGT

AGACTGTATGATGTGTTACATATGGCCAACTGCCTTTTAGCTGGCCTTTTTTATTAATATGCCTGTTTTAAGTGCTTAATACAGTATAATGTGATTGTAA

GTCATGAGCCTATTTTAAATCATTCCCTCCTGTGTATGTGTGCTCTGAGAGAGCTTCATTTTATTCTCCCAGCAGAGTAACTTGTGATGGTTATTTACAT

TCCCCAGAGTGTGCCTCTGGTGTGAATTCTGTCTTCTTATTAAAGTGTCTGCTGCAGAATCCAGTTGCCCTGTCCTTATAAACTTTAAA
Translation
 - UNI16295 - MAQESPKNSAAEIPVTSNGEVDDAHEHGYNR - UNI2208 - DLKHSLPSGLGLSETQITSHGFDSTKEGVTEAGAPQG GGQR

THTKGGPVILADEIKNPAMEKLELVRKWSLNTYK CTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQKQLGDAFAD

LSLKSLELH - UNI2680 - EEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYENAR - UNI27575 - RVEYDAYRTDL

EELNLGPRDANTLPKIEQSQHLFQIHKEKYDKMRSDVSVKLKFLEENK - UNI6287 - VKVLRNQLVLFHSAVAAYFAGNQKQLELTLKQFHVRLKT

PGVDAPSWLEEQ
Transcript ENSMUST00000107687
Sequence
GAGGTCGCGGGTGCAAGTGTCCTCGGCGGTTGGTTGCCCGGAGCCTGTGACAGCTGTAGCTGCTCCCCGCCCCCGAGGCGTGGGGGAGGAGACGAAGGAA

AAGCTCCCGGTTGCGCTTCCGGTCCCTTCTCCCTCTGGCCGACGTGATTCCCGAGGGCTGCGACCGGGAGAGCCCGCGACGGAGCGCTGCCGGCTTCCCC

GCTGACAGACAG - UNI16295 - GTGTCTGCCATGGCTCAAGAATCTCCCAAAAACTCTGCAGCAGAAATCCCAGTAACTAGTAATGGAGAAGTTGA

CGATGCTCATGAGCATGGCTACAATAGG - UNI2208 - GATTTGAAGCATTCATTACCATCTGGACTTGGACTCTCAGAAACTCAGATCACATCTCA

TGGCTTTGACAGTACCAAAGAGGGGGTTACTGAAGCAGGAGCACCCCAAG GTTCCTCAGCACCACCTTTGCCATGTGTTCTGTCTCCCAGCAGGGTGGC

AGCTAGTAAGCTGACCCAGCAAGCAGGTGATCTGACTGTTCCTGCAG GTGGCCAAAGAACACACACAAAAGGAGGACCAGTTATTCTAGCAGATGAAAT

AAAAAATCCTGCAATGGAGAAGTTAGAACTTGTTAGAAAATGGAGTCTCAACACATATAAG TGTACCCGGCAAATTATATCTGAGAAACTAGGCCGTGG

CTCAAGAACTGTGGACCTTGAACTTGAAGCTCAGATTGATATATTAAGAGATAATAAGAAAAAATATGAAAACATTCTGAAACTGGCTCAGACCTTGTCG

ACGCAGCTTTTCCAGATGGTGCACACCCAAAAGCAACTCGGAGATGCCTTTGCTGACCTGAGTTTGAAGTCTCTAGAGCTCCAT - UNI2680 - GAA

GAATTTGGCTATAATGCAGATACACAGAAGCTGCTGGCTAAAAATGGAGAGACTCTTCTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACCTTGG

TGAATAAAACAATTGAAGATACATTAATGACTGTAAAACAGTATGAAAATGCCAG - UNI27575 - AGTTGAATATGATGCGTACCGCACTGATTTG

GAAGAACTGAACCTTGGGCCACGTGATGCAAACACTCTGCCAAAAATTGAGCAGTCGCAGCATCTGTTCCAAATACATAAGGAAAAATATGATAAAATGC

GCAGTGATGTTTCTGTCAAATTGAAATTTCTCGAGGAAAATAAG - UNI6287 - GTCAAAGTGCTACGCAACCAACTGGTCCTCTTCCACAGCGCAG

TTGCTGCCTACTTCGCCGGGAATCAGAAGCAGCTTGAACTGACACTTAAGCAGTTCCATGTCAGATTGAAAACCCCTGGAGTGGACGCTCCATCTTGGCT

CGAAGAACAGTAAACTCCCCTGGAAAAGAAGGAACGGTGTATTGTTAAACAACTAATGAACTAGTAAGAGTTAAGTAGTGTTGGGGAGGCCGTGGAGTGA

CCACCATTGTAGTGGCTCTTGCACAGATAGCTTTTATTTTTCCCTTTTCATACATAACAATTGAGCTGTTAAATTTGATGGGAAGGTAGGTGATTTTTTA

TGTAAACATAATTTCTATAATTCTAAACATAATAATTTTCCTTTTTGAGAAATCCTTTTTGTATTGTGAAGGTTATGGCTATTTCTGTAGGTTGAAATAT

TTAATATAGATTTGCACTGACAAGATAAAAATTCAAGGCTTTTTTTGGTCCCAGAAATGAGGGCCAGCTATAGTTTTCCAAGGGAGGTTTACATGATTTG

TATCAATGTCAGATATTTTATATATGAATATATTCAACATCTTTAAGAAGTTCATGTTTGTGTATTATCTTAAAGAAAAAAGAAGCTGTTTCACAGAATA

AGTTTTATGATGTCCTGCAGTGTCACACAAGGGGCAGCCGAATAAGTGACTGACTGGCCCATAGCTTGTTGCAGATACACTTTAAAAATTAATCTGTAAC

ACTGTAATTTTGTTTAGATATTTATAAAGGTCCGGGAATCACACAGTCATATTTTATGACGTGTTTAAACTTATGAATTTGACAGTTGTGCTAGCAGTTT

TGATTTATAATGAAATCTGCTTAAGAGGGATAGGTTTTGTTATTTTGTTTTGGGTTTTTTTTTAACATGTGGACATGGAAATTATTAGCAGTTTCTAGAG

CAGAAATTTATAGATTAGAAAGCTAGTTTGGGAGTAAATTCCGTTTTGATAGAAGAGAATTTCCAGACTGTGTTCATTGGCTTCCATGCGTGACTATACC

AGTTAAGCCTTAAATCACAGATACGTGCCTTCTCCGATGCAGTAATTCTTGCCCAACCATTGTACATACATGAGGAAACCCCTATGGATAACATTTGATT

CATCTGTAACGTTGGGATATTTTGTCCTCATAAAACCACACTTGAGGTGGATGGTGAAAACAACCTTTGAATTTTATATTTTGTTTCTCTTGATTCCTCT

TGAAGAAGGGGGTGATGGGAAAGTTTTCCCCCTTGGGTAATGAAAAGGTTGTGTAAAGTGTGTGGAGGTCGTAGGACGGAAAATCCAGTGCTGGGTTACT

TGTGTAGCACTGTGGTCTTGTGTATGCGGTTGGCTTGTCTACTGTGTGGTTCCTCAGCGATGTAATCTTGTTTAAATGTAAAGTTCCCTTGATTTTGTCA

TACATATAAATGAGTATTTTCAGAGATCCCACTTCACCTGTTATTTCTATTGTGTTGAAATGAAGTACTTAAAATTACTGTTCTCCGTGAACTCTGTAGA

CTGTATGATGTGTTACATATGGCCAACTGCCTTTTAGCTGGCCTTTTTTATTAATATGCCTGTTTTAAGTGCTTAATACAGTATAATGTGATTGTAAGTC

ATGAGCCTATTTTAAATCATTCCCTCCTGTGTATGTGTGCTCTGAGAGAGCTTCATTTTATTCTCCCAGCAGAGTAACTTGTGATGGTTATTTACATTCC

CCAGAGTGTGCCTCTGGTGTGAATTCTGTCTTCTTATTAAAGTGTCTGCTGCAGAATCCAGTTGCCCTGTCCTTATAAACTTTAAA
Translation
 - UNI16295 - MAQESPKNSAAEIPVTSNGEVDDAHEHGYNR - UNI2208 - DLKHSLPSGLGLSETQITSHGFDSTKEGVTEAGAPQG GSSA

PPLPCVLSPSRVAASKLTQQAGDLTVPAG GGQRTHTKGGPVILADEIKNPAMEKLELVRKWSLNTYK CTRQIISEKLGRGSRTVDLELEAQIDILRDN

KKKYENILKLAQTLSTQLFQMVHTQKQLGDAFADLSLKSLELH - UNI2680 - EEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLM

TVKQYENAR - UNI27575 - RVEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQIHKEKYDKMRSDVSVKLKFLEENK - UNI6287 - VKVLR

NQLVLFHSAVAAYFAGNQKQLELTLKQFHVRLKTPGVDAPSWLEEQ

For any suggestions or comments, please send an email to unitrap@crg.es