Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074519 (Etohi1)
Chromosomal location
Chr 2: 177757989 - 177769842 (+)
Description
ethanol induced 1 Gene [Source:MGI (curated);Acc:Etohi1-001]
MGI
MGI:1261426 
Uniprot/SPTREMBL
Q3V498 A2BFG8 
Human Ortholog
not available
Omim not available
UniTrap UNI2607
Vector Insertion
Chr 2: 177757988 - 177758087
Public Clones XR0875 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33179
Vector Insertion
Chr 2: 177758087 - 177765959
Public Clones (sanger) IST10129G4 (tigm) IST10947A1 (tigm) IST14442C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098999
Sequence
GTAACTCAGCGGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG -

 UNI2607 - - UNI33179 - GATTTAGTCACCTATGATGACGTACATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGA

GTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTA

GAAGTCATGGAAG ATTCTCAAATATTCATCATTATGAAAGAGAGACCCTATGA
Translation
M - UNI2607 - - UNI33179 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSRSHGR RFSNIHH

YERETL
Transcript ENSMUST00000108926
Sequence
GTAACTCAGCGGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG -

 UNI2607 - - UNI33179 - GATTTAGTCACCTATGATGACGTACATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGA

GTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTA

GAAGTCATGGAAG GCATGAAAGAAGTTCTTCTGCAGAGCAACACTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATCAGAGTCATAGTCAAAGGC

ATGAAAGAATACACAATGGAGAGAAACACTGTGAGTGTAACCAATGTGGTAAAGACTTTGGAACAAGGAGTATCCTCCAAAGACTCAAACGAACACATAC

AGGAGAGAAACCCTATGAATGTAACCACTGTGGTAAAGCCTTTGTAGAAAGCTGTACTCTCCAAATCCATAAGCGAAAACATACAGGAGAGAAACCATAT

GAATGTAACCAATGTGGTAAAGCCTTTGCACAAAGCTGTCATCTCAGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTG

GTAAAGCCTTTGCAGTAAGCAGTCATCTCGGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGT

AAGCAGTCATCTCGGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGATAAAGCTTTTGTAAGAAGGGGAAAACTCCAA

ATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTGCACATAGCGGTACTCTCCAAATCCATAAGCGAACAC

ATACAGGAGAGAAACCTTATGAATGTTACCAATGTGGTAAAGCCTTTGCAACAAGCTGTCATCTCCGAAGACATAATCGAACACATTCAGGAGAGAAACA

GTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATACAGGAGACAAACCCTATGAATGTAAACAA

TGTGGTAAAGCCTTTGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTG

CAGAAAGCAGTACTCTCCAAAGACATAAGCGAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCT

CCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCAGTCATCTCCGAATACATAAGCGA

ACACATACAGGAGAGAGACCCTATGAATGTAACTAG
Translation
M - UNI2607 - - UNI33179 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSRSHGR RHERSSS

AEQHSEFIQCGKAFAYQSHSQRHERIHNGEKHCECNQCGKDFGTRSILQRLKRTHTGEKPYECNHCGKAFVESCTLQIHKRKHTGEKPYECNQCGKAFAQ

SCHLRIHKRTHTGEKPYECKQCGKAFAVSSHLGIHKRTHTGEKPYECKQCGKAFAVSSHLGIHKRTHTGEKPYECKQCDKAFVRRGKLQIHKRTHTGEKP

YECKQCGKAFAHSGTLQIHKRTHTGEKPYECYQCGKAFATSCHLRRHNRTHSGEKQYECNQCGKAFASSSDLQKHKRTHTGDKPYECKQCGKAFASSSDL

QKHKRTHTGEKPYECKQCGKAFAESSTLQRHKRTHTGEKPYECKQCGKAFARSCHLQIHKRTHTGEKPYECKQCGKAFARSSHLRIHKRTHTGERPYECN

Transcript ENSMUST00000108925
Sequence
GTAACTCAGCGGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG -

 UNI2607 - - UNI33179 - GATTTAGTCACCTATGATGACGTACATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGA

GTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTA

GAAGTCATGGAAGGTAATTTTCCTCTGCAAGCTGATGAGAAAATGCCTATGAAGAAAGTTTAACGTGTGCTACAAGTAGTAAAGAAAACCAATAGGGTAC

AATAAGCACTGCTTTCAGTTATGGATGTTTATTGAATTTCATAAAATCATATGTCTATGGCAGATATGAAATTATTGTTTGCAAGACTTTCCATTAGTTC

AAAGACAGAGAAATAATGGCTTAACAGGTATGTTACTGTTTAAATCAAGCCTAGTAGAGCCATGCTGTACAAGTGCGAGTGTCTTCAGTCTCATATCGCT

TAGCTATTGCAAAAGGAACACACAGTGATTAGGTGACAAGTCTATGTCTAAAACCTAGTAATAAGCAAATAACCCATAGTATATCTGAGCTCAATGATAT

ACTTGTAATATCATTGCTAAATTTAGTGAGATGGACAGTTCATAAGATTCAAAAATGGTTTGGTGGAAAAACCTTAATCGCTATACTACATCTCTATGAG

GAAAAAAGTCACGTGTGTGAATGTATTATGGAACCTTTACACTTGTTATTCTCTTTTAATATGGTTGTCATACGTTACTATGGATACAGTTCTTGTGAGC

ATAGGGGTATTGAAAGATGCCACATACCTTTCACTTTTTCAGAACAACAAGGGGATATGCAGTATAACATACTTTGAGTGACATTCTAAATGTGCTGTAA

GTTTATAAGTACTTAGTTTCCCAACATTATTGGGGACATTTACCAACTCAAACTGCTGAAAATCATAATGAGAATTAG
Translation
M - UNI2607 - - UNI33179 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es