Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074582 (Arfgef2)
Chromosomal location
Chr 2: 166631215 - 166720671 (+)
Description
ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) Gene [Source:MGI (curated);Acc:Arfgef2-001]
RefSeq_dna
NM_001085495 
RefSeq_peptide
NP_001078964.1 
UniGene
Mm.297192 
MGI
MGI:2139354 
Uniprot/SPTREMBL
A2A5R2 Q3U2F2 Q3U5C3 
Human Ortholog
ENSG00000124198 (ARFGEF2)
Omim 608097 - HETEROTOPIA, PERIVENTRICULAR, AUTOSOMAL RECESSIVE  
UniTrap UNI12287
Vector Insertion
Chr 2: 166631336 - 166652426
Public Clones A057F01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9538
Vector Insertion
Chr 2: 166661958 - 166668184
Public Clones XE380 (baygenomics) XC792 (baygenomics) XC537 (baygenomics) XC646 (baygenomics)
XC796 (baygenomics) XC671 (baygenomics) XC797 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34122
Vector Insertion
Chr 2: 166671102 - 166674366
Public Clones IST13850F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36929
Vector Insertion
Chr 2: 166686197 - 166687083
Public Clones 3SE125B03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3837
Vector Insertion
Chr 2: 166711410 - 166715768
Public Clones AX0334 (sanger)
Private Clones OST406774 (lexicon) OST2334 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21503
Vector Insertion
Chr 2: 166715938 - 166717266
Public Clones not available
Private Clones OST328680 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10411
Vector Insertion
Chr 2: 166717406 - 166719000
Public Clones D069G05 (ggtc)
Private Clones OST384937 (lexicon) OST359493 (lexicon) OST334180 (lexicon) OST103004 (lexicon)
OST102615 (lexicon) OST41476 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8036
Vector Insertion
Chr 2: 166719119 - 166720111
Public Clones RRJ103 (baygenomics) RRJ104 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099078
Sequence
ATGCAGGAAAGCCAGACCAAGAGCATGTTCGTGTCCCGGGCCCTGGAGAAGATCCTAGCTGACAAGGAGGTGAAGCGGCCCCAGCACTCCCAGCTGCGTA

GGGCCTGCCAGGTGGCGCTCG - UNI12287 - ATGAAATTAAAGCAGAACTAGAAAAGCAGAG GCTTGGCGCTGCGGCTCCACCAAAGGCAAACTT

CATTGAAGCTGACAAGTATTTCCTTCCATTCGAGCTGGCCTGCCAATCCAAGTCACCTCGGGTGGTCAGCACATCCCTGGACTGCTTGCAG AAACTCAT

CGCATATGGACACATCACTGGCAATGCCCCTGACAGTGGCGCTCCTGGGAAGCGGCTGATCGACAGGATCGTTGAAACCATTTGCAATTGTTTTCAGGGC

CCTCAGACAGATGAAGGGGTTCAGCTACAAATCATTAAG GCTCTGCTGACTGCTGTGACATCCCCACACATTGAAATCCATGAGGGCACCATCCTGCAG

ACAGTGAGGACCTGCTACAATATCTATCTGGCCAGCAAAAACCTCATCAATCAAACCACCGCCAAGGCCACCCTTACCCAAATGCTGAATGTCATCTTCA

CCCGCATGGAAAACCAAGTG TTACAGGAGGCCAGAGAATTGGAAAAACCAATGCAGTCAAAACCTCAGTCCCCGGTGATCCAGGCCACAGCAGGCTCTC

CCAAGTTCAGCCGCCTGAAGCAGAGCCAGGCCCAGAGCAAACCCACGACTCCTGAGAAAGCAGAGCTGCCCAATGGGGACCATGCCCAGAGTGGCCTAGG

AAAAGTGAGCTTGGAAAATGGAGAAGCTCCCCGAGAGAGAGGCTCGCCAGTCTCTGGGAGAGCCGAGCCTTCGAGGG - UNI9538 - GCACTGACAG

TGGAGCTCAGGAGGTGGTGAAGGACATCTTAGAGGACGTGGTCACGTCTGCTGTGAAAG AAGCAGCAGAAAAGCATGGTCTGCCGGAGCCCGACCGAGC

CCTGGGTGCCCTAGAGTGCCAGGAATGCGCTGTTCCTCCTGGAGTTGATGAAAACTCACAGACCAACGGCATAGCAGACGACAGGCAGTCGCTATCCTCC

GCAGATAATCTG - UNI34122 - GAACCAGATGTTCAAGGACACCAAGTGGCTGCTAGGTTCTCTCACATTCTACAGAAGGATGCCTTCCTGGTGTT

CCGCTCCCTGTGCAAGCTGTCCATGAAGCCCCTTGGGGAAGGGCCACCAGATCCAAA GTCCCACGAGCTTCGTTCCAAGGTGGTTTCCCTGCAGCTGCT

CCTCTCTGTGCTGCAGAATGCTGGCCCAGTCTTCAGGAGCCACGAGATGTTCGTCACTGCCATTAAGCAGTACCTGTGTGTGGCCCTTTCCAAGAATGGC

GTGTCCTCAGTGCCTGACGTCTTCGAACTCTCGCTTGCTATTTTTCTTACTCTTCTTTCAAACTTCAAGATGCACTTGAAAATGCAGATAGAG GTCTTT

TTCAAAGAGATTTTCCTGAACATTTTAGAAACATCCACAAGTTCTTTTGAGCACCGCTGGATGGTCATTCAGACCCTGACGAGGATTTGTGCAG ATGCC

CAGTGCGTTGTGGATATTTATGTCAACTACGACTGTGACTTAAATGCTGCTAACATTTTCGAGCGACTAGTAAATGACTTATCCAAAATTGCTCAGGGAA

GAAGTGGACATGAGCTGGGGATGACACCTCTACAG GAGCTCAGTCTGAGGAAGAAAGGCCTGGAGTGTCTGGTGTCTATTCTCAAGTGCATGGTGGAGT

GGAGCAAGGACCTGTATGTGAATCCCAACCACCAGGCTACCCTGG GTCAGGAGAGGCTCCCAGATCAGGAAATGGGGGACGGAAAAGGCCTTGACATGG

CAAGACGGTGCAGCGTGACATCCGTGGAGTCCACAGTGTCCTCGGGGACCCAGACAGCCATTCAGGATGACCCAGAGCAGTTTGAGGTCATCAAACAACA

GAAGGAAATCATTGAGCATGGCATTGAGCT CTTCAATAAGAAGCCCAAGCGAGGTATCCAGTTTCTCCAAGAGCAAGGCATGCTGGGAGCAGCTGTAGA

AGATATTGCCCAATTTCTGCACCAGGAGGAGCGGCTGGATTCT ACCCAGGTTGGCGAGTTTCTGGGAGACAGCACGAGGTTTAACAAGGAGGTGATGTA

TGCCTATGTGGACCAACTGGATTTCTGTGAAAAAGAGTTCGTCTCAGCCCTGAGGACATTCCTGGAGGGCTTCCGCCTGCCTGGGGAAGCCCAGAAGATT

GACCGGTTAATGGAGAAGTTTGCTGCACGATACATAGAATGTAACCAAGG GCAAACCCTGTTTGCTAGTGCGGACACTGCGTATGTCCTGGCGTACTCC

ATCATCATGCTGACCACAGACCTGCACAGCCCACAG GTAAAGAATAAGATGACAAAAGAGCAGTATATTAAAATGAACCGGGGCATCAACGACAGCAAA

GACCTGCCTGAGGAGTACCTGTCCAGCATCTATGACGAGATAGAGGGCAAGAAGATAGCGATGAAGGAGACAAAGGAGCACACAATTGCGACCAAGTCCA

CCAAGCAGA GTGTAGCTAGTGAAAAGCAGAGGCGGCTGCTGTACAATGTGGAGATGGAGCAGATGGCTAAAACAGCCAAAGCTCTGATGGAGGCCGTGA

GCCATGCCAAAGCCCCGTTTACCAGCGCCACACACTTGGACCATGTCCGGCCAATGTTCAAA CTGGTGTGGACGCCGCTGCTGGCAGCCTATAGTATTG

GCCTGCAGAACTGTGATGACACGGAGGTGGCCTCCCTGTGTTTGGAAGGCATCAGGTGTGCAGTCCGCATTGCCTGCATCTTTGGAATGCAG CTGGAAC

GAGATGCCTATGTTCAGGCCCTTGCTCGCTTTTCCCTGCTGACAGCCAGCTCCAGCATCACAGAAATGAAGCAGAAAAACATCGACACCATAAAGACACT

CATCACTGTGGCTCACACCGATGGCAACTACCTTGGCAACTCCTGGCATGAG ATCTTGAAGTGCATCAGCCAGCTGGAGCTTGCTCAGCTGATAGGAAC

TGGGGTGAAGACTCGCTACCTCTCTGGCTCTGGGCGGGAACGAGAAGGGAGCCTGAAGGGCCACAGTCTGGCAGGAGAAGAATTCATGGGTCTTGGCCTC

G GTAACTTGGTGAGTGGTGGTGTAGACAAAAGACAGATGGCCAGCTTCCAGGAGTCGGTTGGTGAAACAAGCTCACAGAGTGTGGTTGTCGCAGTTGAC

AG AATTTTTACTGGCTCTACCAGACTGGATGGAAATGCAATAG TTGACTTTGTCCGTTGGCTGTGTGCTGTGTCCATGGATGAGCTGGCTTCTCCCCA

CCATCCTCGAATGTTCAGCCTGCAGAAGATTGTGGAAATATCATACTACAACATGAACAGGATCCGGCTGCAGTGGTCTCGGATATGGCATGTCATTGGA

GATCACTTCAATAAG GTCGGCTGTAACCCCAATGAAGATGTGGCCATCTTCGCAGTTGACTCTCTGCGGCAGCTCTCCATGAAGTTCCTGGAGAAGGGA

GAATTAGCCAACTTCCGATTTCAGAAGGATTTTCTGAGGCCATTTGAACATATTATGAAGAAAAACAG GTCCCCGACCATCCGGGACATGGTGATCCGA

TGCATCGCTCAGATGGTGAGCTCCCAGGCAGCCAACATCCGCTCAGGCTGGAAGAACATCTTTGCTGTGTTCCACCAGGCTGCCTCTGACCACGATGGGA

ACATTGTGGAGCTGGCCTTCCAAACCACAGGCCACATCGTCT CAACCATCTTCCAGCACCACTTCCCTGCAGCCATCGACTCCTTCCAGGATGCTGTGA

AGTGCTTGTCTGAGTTCGCCTGCAATGCAGCTTTCCCTGACACCAGCATGGAGGCCATCCGGCTCATCCGCTTCTGTGGGAAATACGTCTCAGAGAGGCC

TCGG GTGCTGCAAGAGTACACAAGTGATGATATGAATGTGGCTCCTGGTGACAGGGTCTGGGTCAGAGGCTGGTTTCCCATCCTGTTTGAACTCTCCTG

CATCATTAACAGATGCAAGTTAGATGTACGCACAAG GGGACTCACGGTCATGTTTGAGATTATGAAGAGCTATGGCCACACCTTTGCAAAGCACTGGTG

GCAGGACCTGTTCAGAATCGTGTTTCGAATTTTTGACAACATGAAACTCCCTGAGCAACAGTCAGAG AAATCAGAGTGGATGACGACCACGTGCAATCA

TGCACTGTACGCTATTTGTGACGTATTCACCCAGTTCTACGAAGCTTTGCATGAAGTGCTTCTCTCTGATGTGTTTGCGCAGCTGCAGTGGTGCGTGAAA

CAAG ATAATGAGCAGTTGGCCCGATCAGGTACGAACTGCTTAGAGAACCTAGTGATATCCAACGGCGAGAAGTTCAGCCCTGCTGTCTGGGATGAAACC

TGCAATTGCATGTTGGATATTTTCAAAACCACCATCCCACATGT TTTGCTGACGTGGAGACCTGCGGGGATGGAGGAGGAGGTGTCAGATAGACATCTG

 GATGTGGACCTAGACCGCCAGTCTTTAAGCAGCATAGACAGAAACGCCTCCGAGAGAGGACAGAGCCAGCTGTCCAACCCCACTGACGACAGCTGGAAG

GGGGCACCGTATGCAC ATCAGAAACTGCTGGCCAGCCTCCTCATCAAGTGTGTGGTTCAGCTGGAGCTGATCCAGACCATTGACAACATCGTGTTCTAC

CCTGCCACCAGCAAGAAGGAGGATGCGGAGCACATGGTTGCTGCCCAG - UNI3837 - CAAGACACCCTCGATGCAGAGATCCACATCGAGACGGAG

AATCAGGGCATGTACAAGTTCATGTCCTCCCAGCACCTCTTCAAGCTGCTGGACTGCCTGCAGGAGTCCCACTCCTTCTCCAAAGCCTTCAACTCCAACT

ATGAGCAGCGGACTGTCCTCTGGCGAGCTG - UNI21503 - GCTTCAAGGGCAAGTCCAAACCCAATCTTCTCAAACAAGAAACCAGCAGCCTGGCC

TGTTGTCTAAGGATCCTGTTTAGAATGTACGTTGATGAGAACCGCAGGGATTCCTGGGACGAAATACAGCAGCGACTTCTAAG - UNI10411 - AGT

GTGCAGTGAAGCACTTGCCTATTTCATTACTGTGAACTCCGAGAGCCATCGGGAAGCATGGACGAGCCTCCTGCTGCTACTTCTAACCAAAACCCTCAAG

ATAAGCGATGAAAAG - UNI8036 - TTCAAAGCACACGCGTCAATGTACTACCCCTACCTGTGTGAAATTATGCAGTTTGACCTGATCCCTGAGCTC

CGAGCAGTTCTGCGAAAGTTCTTCCTGCGGATAGGCCTGGTGTATAAGATATGGATTCCAGAAGAGCCGTCGCAAGTGCCAGCAGCACTGTCATCGACCT

GGTAGCACTGGCTGCATGGCCACTGCTGTGGTTCTGTAGAACATCCGCCATGCCGTCCCAGCTGGCGGAGGGGGAGCTGCCCACCTAGCTGGGTTTGGAC

CTGGAGTGCAGTGGCGTGAACCCTGGTCAGCACAGTCCCCAGCGGAGGCTCATGGTGTCTCATTAAACCATCACATACCAGTAACTCGGTGGGCAGGGAG

TCTGTTCCCCCGTCCTTGCATTCCGCTGGCTGACCTGTTAGACCTGTCCTTGTGAATGCCACCGTTTCCTCTAAGACTGGCCATTAATGTTTCGTCGGCG

GAAGTCGCTCTCCTGGGAGGCAATGAGCATTGCCGTATAGGTTCCTGTTTATTAGAGAGTATGCTAATAAAAGTCCTTGTAATAGCTC
Translation
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALD - UNI12287 - DEIKAELEKQR RLGAAAPPKANFIEADKYFLPFELACQSKSPRV

VSTSLDCLQ KLIAYGHITGNAPDSGAPGKRLIDRIVETICNCFQGPQTDEGVQLQIIK ALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQTT

AKATLTQMLNVIFTRMENQV LQEARELEKPMQSKPQSPVIQATAGSPKFSRLKQSQAQSKPTTPEKAELPNGDHAQSGLGKVSLENGEAPRERGSPVSG

RAEPSRG - UNI9538 - GTDSGAQEVVKDILEDVVTSAVKE EAAEKHGLPEPDRALGALECQECAVPPGVDENSQTNGIADDRQSLSSADNL - U

NI34122 - EPDVQGHQVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPK KSHELRSKVVSLQLLLSVLQNAGPVFRSHEMFVTAIKQYLCVALS

KNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIE VFFKEIFLNILETSTSSFEHRWMVIQTLTRICAD DAQCVVDIYVNYDCDLNAANIFERLVNDLS

KIAQGRSGHELGMTPLQ ELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQATLG GQERLPDQEMGDGKGLDMARRCSVTSVESTVSSGTQTAIQDDPE

QFEVIKQQKEIIEHGIEL LFNKKPKRGIQFLQEQGMLGAAVEDIAQFLHQEERLDS TQVGEFLGDSTRFNKEVMYAYVDQLDFCEKEFVSALRTFLEG

FRLPGEAQKIDRLMEKFAARYIECNQG GQTLFASADTAYVLAYSIIMLTTDLHSPQ VKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYDEIEGKKIAM

KETKEHTIATKSTKQS SVASEKQRRLLYNVEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFK LVWTPLLAAYSIGLQNCDDTEVASLCLEGIR

CAVRIACIFGMQ LERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHE ILKCISQLELAQLIGTGVKTRYLSGSGREREGS

LKGHSLAGEEFMGLGLG GNLVSGGVDKRQMASFQESVGETSSQSVVVAVDR RIFTGSTRLDGNAIV VDFVRWLCAVSMDELASPHHPRMFSLQKIVE

ISYYNMNRIRLQWSRIWHVIGDHFNK VGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNR RSPTIRDMVIRCIAQMVSSQA

ANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVS STIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPR VLQEYT

SDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTR RGLTVMFEIMKSYGHTFAKHWWQDLFRIVFRIFDNMKLPEQQSE KSEWMTTTCNHALYAI

CDVFTQFYEALHEVLLSDVFAQLQWCVKQD DNEQLARSGTNCLENLVISNGEKFSPAVWDETCNCMLDIFKTTIPHV VLLTWRPAGMEEEVSDRHL D

VDLDRQSLSSIDRNASERGQSQLSNPTDDSWKGAPYAH HQKLLASLLIKCVVQLELIQTIDNIVFYPATSKKEDAEHMVAAQ - UNI3837 - QDTL

DAEIHIETENQGMYKFMSSQHLFKLLDCLQESHSFSKAFNSNYEQRTVLWRAG - UNI21503 - GFKGKSKPNLLKQETSSLACCLRILFRMYVDEN

RRDSWDEIQQRLLR - UNI10411 - RVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKISDEK - UNI8036 - FKAHASMYYPYLCEIMQFD

LIPELRAVLRKFFLRIGLVYKIWIPEEPSQVPAALSSTW

For any suggestions or comments, please send an email to unitrap@crg.es