Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074652 (Myh7b)
Chromosomal location
Chr 2: 155436979 - 155459827 (+)
Description
myosin, heavy chain 7B, cardiac muscle, beta Gene [Source:MGI (curated);Acc:Myh7b-001]
RefSeq_peptide
NP_001078847.1 
UniGene
Mm.469980 
MGI
MGI:3710243 
Uniprot/SWISSPROT
A2AQP0 
Human Ortholog
ENSG00000078814 (MYH7B)
Omim not available
UniTrap UNI28925
Vector Insertion
Chr 2: 155443662 - 155444469
Public Clones not available
Private Clones OST15920 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092995
Sequence
GTCCTCACCGTGGTGCCAG AGCCCGCTGCCTAGGACTGCTTTGAGTTGCTGCCCCGGTTTTCAGGTCCTCCTTTTGCACCTCTCGCCACCATGATGGAT

ATGAGTGAACTTGGAGAATCAGCCTGCTACCTCCGCCAGGGCTACCAGGAAATGATGAAGGTGCACACTGTCCCATGGGATG GTAAGAAACGGGTCTGG

GTGCCTGATGAGCAGGATGCCTATGTGGAGGCTGAGGTCAAGACTGAAGCTACTGGAGGCAAAGTCACTGTGGAGACCAAAGACCAGAAG GTGCTGACA

GTGCGTGAAACGGAGATGCAACCCATGAACCCACCCCGTTTCGACTTACTGGAGGACATGGCCATGATGACGCACCTCAACGAGGCTGCAGTGCTGCATA

ACCTGCGGCAGCGCTATGCTCGCTGGATGATCTAC ACATACTCGGGCCTCTTCTGTGTCACCATTAACCCATACAAATGGCTCCCGGTCTACACAGCTG

CTGTGGTGGCTGCCTACAAGGGCAAGCGTCGCTCCGAGGCCCCACCTCATATATATGCAGTGGCAGATAATGCCTACAACGACATGCTCCGCA ACCGAG

AGAATCAGTCCATGCTGATCAC CGGAGAGTCGGGGGCCGGTAAGACGGTTAACACCAAGCGGGTCATTCAGTACTTTGCCATCGTCGCTGCCCTGGGAG

ACGGGCCGGGCAAGAAGGCA CAATTTCTGGCGACAAAGACAGGG GGCACCCTTGAGGATCAAATCATCGAGGCTAACCCTGCCATGGAGGCTTTTGGC

AACGCCAAGACTCTGAGGAACGACAACTCCTCCCGTTTT GGCAAGTTCATCCGCATCCACTTTGGTCCCACTGGGAAGCTGGCCTCTGCGGACATTGAT

AGCT - UNI28925 - ATCTCCTGGAGAAGTCGCGAGTGATCTTCCAGCTGCCCGGTGAGCGTGGTTACCATGTCTACTACCAGATCCTCTCAGGGAA

GAAGCCGGAGCTGCAGG ACATGCTGCTCCTGTCCATGAATCCCTACGACTACCACTTCTGCAGCCAGGGGGTCACCACTGTGGACAACATGGATGACGG

CGAGGAACTTATCGCCACTGAT CATGCAATGGATATCCTGGGCTTCAGTGTGGATGAGAAGTGTGCCTGCTATAAGATCGTGGGTGCTCTCCTGCACTT

TGGCAACATGAAGTTCAAACAGAAGCAGAGAGAGGAACAGGCTGAGGCAGACGGCACTGAGA GTGCGGACAAGGCTGCCTACTTGATGGGTGTCAGCAG

CGGGGACCTCCTCAAAGGTCTCCTGCATCCCCGGGTTCGTGTGGGAAATGAGTATGTTACCAAGGGCCAGAGTGTGGAGCAG GTGGTATTTGCCGTGGG

GGCCCTGGCCAAGGCTACCTACGACCGGTTGTTCCGATGGCTGGTTTCTCGAATCAATCAGACCCTGGACACAAAGCTCCCTCGACAGTTCTTTATCGGG

GTCCTGGACATCGCTGGTTTTGAGATTTTTGAG TTTAACAGCTTCGAGCAGCTGTGCATCAACTTCACCAACGAGAAGCTGCAGCAGTTCTTCAACCAG

CACATGTTCGTGCTGGAGCAGGAGGAGTACAAGCGGGAGGGCATCGACTGGGTCTTCATCGACTTCGGCCTTGACCTGCAGCCTTGTATCGACCTCATCG

AGAAG CCTCTGGGCATCCTGTCCATCCTGGAGGAGGAGTGCATGTTCCCCAAGGCTTCAGACGCAAGCTTCAGGGCCAAGCTCTATGACAATCATTCTG

GGAAGTCACCTAATTTCCAGCAGCCTCGCCCAGACAAGAAACGCAAGTACCAGGCTCACTTCGAGGTGGTCCACTACGCAGGCGTG GTTCCTTATAGCA

TCGTGGGCTGGCTGGAGAAAAACAAGGATCCCCTCAATGAGACGGTGGTCCCCATCTTCCAAAAGTCACAGAATAGGCTCTTGGCCACCCTCTATGAGAA

CTATGCAGGTTCTTGCTCCA CCGAGCCCCCCAAGTCTGGGGTGAAAGAGAAGCGCAAGAAAGCAGCATCATTTCAGACCGTGTCTCAGCTTCACAAG G

AGAACCTCAACAAGCTCATGACCAACCTGCGGGCCACACAGCCCCATTTCGTCCGCTGTATCGTCCCCAACGAGAACAAGACTCCAG GGGTCATGGATT

CCTTCTTGGTGTTACACCAACTACGCTGCAACGGGGTCTTGGAGGGAATCCGGATCTGCCGCCAAGGGTTCCCCAACAGACTGCTGTATGCTGACTTCAG

GCAGCG GTACCGAATCCTGAACCCCAGTGCCATCCCAGACGACACCTTTGTGGACAGCAGAAAGGCCACAGAGAAGCTGCTGGGCTCCCTGGACATCGA

CCACACTCAGTATCAGTTTGGCCACACCAAG GTGTTCTTCAAGGCTGGGCTTCTAGGCATCCTGGAGGAGCTGCGGGACCAGCGTCTGGCTAAGGTGTT

GACACTGCTGCAGGCTCGGAGCCGGGGCCGCCTCATGCGGCTGGAGTACCAGCGCATGCTAGGGGGAAG GGATGCCCTGTTCACCATACAGTGGAACAT

CCGGGCCTTTAATGCCGTCAAGAACTGGTCCTGGATGAAGCTCTTCTTCAAGATGAAGCCACTGCTGCGCTCAGCACAGGCGGAGGAGGAGCTGGCGGCA

CTGCGGGCAGAGCTGCGGGGGCTGCGAGGGGCCCTGGCTACGGCTGAGGCTAAGCGGCAGGAGCTGGAGGAGACTCAAGTCAGTGTCACTCAGGAGAAGA

ACGACCTGGCCCTGCAGCTGCAGGCA GAGCAGGACAACCTCGCAGATGCAGAGGAGCGCTGCCACTTGCTGATCAAGTCCAAGGTGCAGCTGGAGGCGA

AGGTGAAGGAGCTGAGCGAGCGGCTGGAGGACGAGGAGGAAGTGAACGCGGACCTGGCCGCCCGCAGGCGCAAGCTGGAGGACGAGTGCACGGAGCTCAA

GAAAGACATCGATGACCTGGAGCTGACGCTGGCCAAGGCCGAGAAAGAGAAACAAGCCACAGAGAACAAG GTGAAGAACCTGACAGAAGAGATGGCGGC

ACTGGATGAAGCCGTGGTCCGCCTGACTAAGGAGAAGAAGGCATTGCAGGAGGCTCACCAGCAGGCTCTGGGTGACCTGCAGGCTGAGGAGGACCGTGTG

AGCGCACTGGCCAAGGCCAAGATCCGGTTGGAACAGCAAGTGGAGGAT CTGGAGTGCTCCCTGGAGCAAGAGAAGAAGCTGCGCATGGACACAGAACGC

GCCAAGCGCAAACTTGAAGGAGACTTGAAGCTGACGCAGGAGACGGTGACAGACACAACACAAGACAAGCAGCAGTTGGAGGAGAAGTTGAAGAA GAAG

GATTCGGAGCTGAGTCAGCTGAACCTGCGGGTGGAGGATGAGCAGCTCGTGGGGGTGCAGCTGCAGAAGAAGATCAAGGAGCTGCAG GCTAGGGCCGAG

GAGCTGGAGGAGGAGCTGGAGGCGGAGCGAGCAGCCCGCGCCCGCGTGGAAAAGCAGCGAGCCGAGGCAGCGCGGGAGCTGGAGGAGCTGAGCGAGAGGC

TGGAGGAGGCTGGCGGAGCTTCCGCGGGGCAGCGTGAGGGTTGCCGCAAGCGTGAGGCTGAGTTGGGCCGGCTGCGGCGGGAGCTGGAGGAGGCAGTTCT

GAGGCACGAGGCCACTGTGGCTGCCCTGCGCCGCAAGCAGGCCGATAGCGCTGCAGAGCTGAGCGAGCAGGTGGACAGCCTGCAGCGCATCCGGCAGAAA

CTGGAAAAGGAGAAGAGCGAGCTGCGCATGGAGGTGGACGATCTGGGCGCCAGCGTGGAAACTCTGGCCCGTGGCAAG GCCAGTGCGGAAAAGCTGTGT

CGGACCTATGAGGACCAGCTGAGCGAGGCCAAAATCAAAGTGGAGGAGCTGCAGCGACAGCTGGCCGACGCCAGCACCCAGCGGGGGCGGTTACAAACGG

AGAATG GGGAGCTGGGCCGCCTGCTGGAGGAGAAGGAGTCCATGATCAGCCAGCTGAGCCGCGGGAAGACCTCAGCAGCGCAGAGTCTGGAGGAACTTC

GGCGGCAGCTGGAGGAAGAAAGCAAG GCCAAGGGTGCGCTGGCTCATGCAGTGCAGGCCCTGCGGCACGACTGCGACCTCCTCCGAGAGCAGCACGAGG

AAGAGTCTGAGGCTCAGGCTGAGCTGCAGCGGCTGCTGTCCAAAGCCAACGCGGAGGTGGCCCAGTGGCGGAGCAAGTATGAAGCAGATGCCATCCAAAG

GACGGAGGAGCTGGAGGAGGCCAA GAAGAAGCTGGCCCTGCGGCTGCAAGAGGCAGAAGAAGGCGTAGAGGCCGCAAATGCCAAATGCTCCTCACTGGA

GAAGGCCAAGCTGCGGCTGCAGACAGAGTCGGAGGATGTGACCTTGGAGCTGGAGCGGGCCACCTCGGCCGCCGCAGCCCTGGATAAGAAGCAGCGGCAC

TTGGAGCGGGCGCTGGAGGAGCGGAGGCGGCAGGAGGAGGAGATGCAGCGGGAACTCGAGGCGGCACAGAGGGAGGCTCGAGGTCTGGGGACAGAGCTCT

TTCGACTGCGACATAGCCACGAGGAAGCGCTTGAGGCTCTGGAGACACTCAAGCGGGAGAACAAGAATCTGCAGG AGGAGATCAGTGACCTTACAGACC

AGGTCAGCCTCAGCGGGAAGAGCATCCAGGAACTGGAGAAGGCCAAGAAGGCGCTGGAAGGGGAGAAGAGTGAGCTGCAAGCTGCACTGGAGGAGGCTGA

G GGGGCACTGGAGTTGGAAGAGACAAAGACTCTACGGATCCAGTTGGAGTTGTCCCAGGTCAAGGCAGAGGTGGACCGGAAGCTGGCGGAGAAGGACGA

GGAGTGTACTAACCTGAG GCGCAACCACCAGCGGGCTGTGGAATCCCTGCAGGCCTCCCTGGATGCAGAGACAAGGGCCCGCAATGAAGCACTGCGCCT

CAAGAAGAAGATGGAGGGGGACCTCAACGACCTGGAGCTACAGCTGGGCCACGCAACCCGCCAGGCCATGGAGGCACAGGCAGCCACGAGGCTGCTGCAG

GCTCAACTCAAGGAGGAACAAGCAGGGCGAGATGAGGAGCAGAGGCTGGCTGCCGAGCTCCGTGAGCAGGGTCAAGCCCTCGAGCGCAGGGCTGCACTGC

TGGCGGCTGAGCTGGAAGAGCTTCGGGCTGCCCTGGAACAGGGCGAGCGCAGCCGGAGGCTGGCTGAGCAGGAGCTGCTGGAGGCCACCGAGCGCCTCAA

CCTACTGCATTCGCAG AACACAGGCCTCCTGAACCAGAAAAAGAAGCTGGAGGTGGACTTGGCCCAGCTGAGTGGGGAAGTGGAGGAGGCTGCGCAGGA

GAGGCGTGAAGCTGAGGAGAAGGCCAAAAAGGCCATCACTGAT GCAGCCATGATGGCCGAGGAGCTGAAAAAGGAACAGGACACGAGCGCACACCTGGA

ACGGATGAAGAAGACCCTGGAACAGACCGTGCGGGAGCTGCAGGCACGCCTTGAGGAAGCCGAGCAGGCCGCACTTCGGGGTGGGAAGAAGCAAGTGCAG

AAGCTGGAGGCCAAG GTGCGGGAGCTGGAGGCCGAGCTGGATGCAGAGCAGAAAAAGCATGCCGAGGCCCTCAAGGGGGTGCGTAAACACGAGCGCCGG

GTCAAGGAGCTCGTGTACCAG ACTGAAGAGGACAGGAAGAACCTGGCTCGCATGCAGGACCTGGTGGACAAGCTGCAGAGCAAGGTCAAGAGCTACAAG

CGTCAGTTTGAGGAGGCG GAGCAGCAGGCCAGTACCAACCTGGCTAAGTACCGCAAGGCCCAGCACGAGCTGGATGATGCCGAGGAACGGGCAGACATG

GCAGAGACCCAGGCCAACAAGCTGCGGGCAAGGTCCAGGGATGCCCTGGGCCCCAAG CACAAGGAGTGA
Translation
 MMDMSELGESACYLRQGYQEMMKVHTVPWDG GKKRVWVPDEQDAYVEAEVKTEATGGKVTVETKDQK VLTVRETEMQPMNPPRFDLLEDMAMMTHLN

EAAVLHNLRQRYARWMIY TYSGLFCVTINPYKWLPVYTAAVVAAYKGKRRSEAPPHIYAVADNAYNDMLRN NRENQSMLIT TGESGAGKTVNTKRVI

QYFAIVAALGDGPGKKA QFLATKTG GTLEDQIIEANPAMEAFGNAKTLRNDNSSRF GKFIRIHFGPTGKLASADIDSY - UNI28925 - YLLEK

SRVIFQLPGERGYHVYYQILSGKKPELQD DMLLLSMNPYDYHFCSQGVTTVDNMDDGEELIATD HAMDILGFSVDEKCACYKIVGALLHFGNMKFKQK

QREEQAEADGTES SADKAAYLMGVSSGDLLKGLLHPRVRVGNEYVTKGQSVEQ VVFAVGALAKATYDRLFRWLVSRINQTLDTKLPRQFFIGVLDIAG

FEIFE FNSFEQLCINFTNEKLQQFFNQHMFVLEQEEYKREGIDWVFIDFGLDLQPCIDLIEK PLGILSILEEECMFPKASDASFRAKLYDNHSGKSPN

FQQPRPDKKRKYQAHFEVVHYAGV VPYSIVGWLEKNKDPLNETVVPIFQKSQNRLLATLYENYAGSCST TEPPKSGVKEKRKKAASFQTVSQLHK EN

LNKLMTNLRATQPHFVRCIVPNENKTPG GVMDSFLVLHQLRCNGVLEGIRICRQGFPNRLLYADFRQR RYRILNPSAIPDDTFVDSRKATEKLLGSLD

IDHTQYQFGHTK VFFKAGLLGILEELRDQRLAKVLTLLQARSRGRLMRLEYQRMLGGR RDALFTIQWNIRAFNAVKNWSWMKLFFKMKPLLRSAQAEE

ELAALRAELRGLRGALATAEAKRQELEETQVSVTQEKNDLALQLQA EQDNLADAEERCHLLIKSKVQLEAKVKELSERLEDEEEVNADLAARRRKLEDE

CTELKKDIDDLELTLAKAEKEKQATENK VKNLTEEMAALDEAVVRLTKEKKALQEAHQQALGDLQAEEDRVSALAKAKIRLEQQVED LECSLEQEKKL

RMDTERAKRKLEGDLKLTQETVTDTTQDKQQLEEKLKK KKDSELSQLNLRVEDEQLVGVQLQKKIKELQ ARAEELEEELEAERAARARVEKQRAEAAR

ELEELSERLEEAGGASAGQREGCRKREAELGRLRRELEEAVLRHEATVAALRRKQADSAAELSEQVDSLQRIRQKLEKEKSELRMEVDDLGASVETLARG

K ASAEKLCRTYEDQLSEAKIKVEELQRQLADASTQRGRLQTENG GELGRLLEEKESMISQLSRGKTSAAQSLEELRRQLEEESK AKGALAHAVQALR

HDCDLLREQHEEESEAQAELQRLLSKANAEVAQWRSKYEADAIQRTEELEEAK KKKLALRLQEAEEGVEAANAKCSSLEKAKLRLQTESEDVTLELERA

TSAAAALDKKQRHLERALEERRRQEEEMQRELEAAQREARGLGTELFRLRHSHEEALEALETLKRENKNLQE EEISDLTDQVSLSGKSIQELEKAKKAL

EGEKSELQAALEEAE GALELEETKTLRIQLELSQVKAEVDRKLAEKDEECTNLR RRNHQRAVESLQASLDAETRARNEALRLKKKMEGDLNDLELQLG

HATRQAMEAQAATRLLQAQLKEEQAGRDEEQRLAAELREQGQALERRAALLAAELEELRAALEQGERSRRLAEQELLEATERLNLLHSQ NTGLLNQKKK

LEVDLAQLSGEVEEAAQERREAEEKAKKAITD AAMMAEELKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQKLEAK VRELEAELD

AEQKKHAEALKGVRKHERRVKELVYQ TEEDRKNLARMQDLVDKLQSKVKSYKRQFEEA EQQASTNLAKYRKAQHELDDAEERADMAETQANKLRARSR

DALGPK HKE

For any suggestions or comments, please send an email to unitrap@crg.es