Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074731 (Zfp345)
Chromosomal location
Chr 2: 150296727 - 150310827 (-)
Description
zinc finger protein 345 Gene [Source:MGI (curated);Acc:Zfp345-001]
RefSeq_peptide
NP_001030072.2 
UniGene
Mm.451002 
MGI
MGI:3652219 
Uniprot/SPTREMBL
A2AQA1 Q3UML8 
Human Ortholog
not available
Omim not available
UniTrap UNI7604
Vector Insertion
Chr 2: 150300619 - 150310715
Public Clones RST355 (baygenomics) RRR458 (baygenomics) 3SD186H07 (ggtc) 5SD186H07 (ggtc)
IST13438H6 (tigm)
Private Clones OST368459 (lexicon) OST235169 (lexicon) OST57714 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22126
Vector Insertion
Chr 2: 150300293 - 150300491
Public Clones not available
Private Clones OST307780 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109914
Sequence
GTAAGTTCCTGTCTGAATCTGAGCCTGAAAGAAGGTTTCTCTGCGGTGTGTCCTGAGTGCCTCTGCTGGGTGCTGTGAGGGAGCTCTGAAAAGCTTAAAA

TTTCCGGACATG - UNI7604 - GGTAGAGTGACCTATGATGATGTGCATGTGAACTTCACGTGGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAG

AATCTCTACAGAGATGTGATGCTGGAGACCTACAGGAATCTCGCTGCTATAG - UNI22126 - GCTATGTTTGGGAAGACCATAATATGGAAGAGCA

TCTTCATATTTCTAGAAGATATGGAAG GCATGAAAGAAGTCATACTGAACAGCTGCTCTCTGAGTTTATCCAATGTGATAAAGCCTTTGCATTTCAGAG

TCATAACCAAAGACAAGAAAGAATTTATACTGCAGAGACACCCTATGAATGTAACCAATGTGGTAAATCCTTTGCGAGAAAGAGTCATCTCCTAAGACAG

AAAAGAACACATACTGGAGAGAAACCCTTTCAATGTAACCAATGTGGTAAAACTTTTGCTCGAAATACTCATCTCCTACAACATAAAAAAGTACACACTG

GAGAGAAACCCTATGAATGCAATCAATGTGACAAAGCCTCTGTATGTCATATTGGTCTCCTGTATCATAAAAGAACACATGCTGGAGAGAGACCATATGA

ATGGAATGAATGTGGTAAATCCTTTGTATATCACAGTTGTATTAAACAATGTAAAAGAAGACATGCTGGAGAGACACCCTTTGAATGTAACCAATGTGGT

AAATCCTTTGCAAGAAAGAGTAATCTCCTAAGACATAAAAGAATACATACTGGTGAGAAACCTTATAAGTGTGACCAATGTGGTAAAGATTTTGCAAGTC

CCAGTTCTTTTAAATGCCATAAAAGAAAACATACTGGTGAGAAACCTTATAAGTGTGACCAATGTGGTAAAGACTTTGCAAGTCCCAGTTCTCTTCAATA

CCATAAAAGAATTCATACAGGAGAGAAACCTTATGAATGTATACAGTGTGGTAAAGCCTTTGCACGTTTAAGTATTCTCCGAAGACATAAAAGAACACAT

ACTGGAGAAAAACCCTTTGAATGTAACCAATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAAGAATACATACTGGTGAGAAACAAC

ATAAAAGAACACATACTGGAGAAAAATCCTTTGAATGTAACGAATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAAGAATACATAC

TGGTGAGAAACCTTATAAGTGTGACCAGTGTGGTAAAGATTTTGCATGTCCCAATTCTCTTCAATACCATAAAAGAGTTCATACAGGAGAGAAACCTTAT

GAATGTAAACAATGTGGTAAAGCCTTTGCATTTTCAACTAGTCTCCGAATACATAAAAGAAGACATACAGGAGAGAAACCCTATGAATGCAATCAATGTG

ATAAAGCCTTTTTGTGTCCAAGTGGACTCCTGTATCATAAACGAACACATACTGGAGAGAGACCATATGAATGCAACGAATGTGGTAAATCCTTCATACA

TCACAGTAGTTTTCGAATGCATAAAAGAACACATACTGGAGAGAAACCCTTTGAATGTGACCAATGTGGTAAAAGCTTTGCACAAAACACTTATCTTTTA

CAACATAAAAGAGTACACACTGGAGAAAAACCCTATGAATGTAAGCATTGTGGCAAAGCCTTTGCATATTCTAATAATCTCCAAGTGCATATTAGAACAC

ATACTAAGTATTTAGTATGGTAAAGCTTTTTCAAATGTCACAAGTTTTCATAATCATGAAAGAGAAACCCTATGAGTGTATTCAGTATGTTTAAACCTTT

GCACATTTCTATAATCTTCATCATGAACGTATTCATATTGTAGAGAAAGTCTGTGAGTGTAAGCAATGTGGTAAAGCCTTTGTGTAATAGGGTCCTCTGA

GATCCAACACAACTCAAACTCATGTAATGCAAGTGACTAGAATTTATTGTAACGAAGCTGCTGCTGATGGAACAGGGCTAGAGAACACACTTGAAAGCTG

AACTGTGACAGTCCCCCCACTCACCTTGATACTGAACCAGAGTGTTATATAGAGAGTTTTTATGTTTGAAAACCAGAAACATTTGTGCCAAATTACAGCT

ACATTTTCCCACCACTCAGAATTAATGATAGGGGCTTTCCTCATGTAGTCTTCTATGTCAGCTGATACAGAATGTGGGTGCTACAATCTAATCAATCATA

TCCATTTGTTGTTTTGTGGTTAGGAATAGACATTGTTTTGATGAATAAAAGATGCATAGAAAAAGAAATTGTTAGGGGCAGTCATGGTTTTTTTTTGTTT

GTTTGTTTGTTTTTTTTTGTTTTTTTTTTTGAGACAGGGTTTCTCTGTGTAGTCCTGGCTGTCCTGGAACTCGCTCTGTAGACCAGGCTGGCCTCGAACT

CAGAAATCCGCCTGCCTCTGCCTGCCAAGTGCTAGAATTAAAGGCGTGTGCCACCACGCCCGGCCAGTCATGGTTTTTATGAACAAAAGATGTATAATTG

AAGCTGGTCCACTATTTGTAAGTCTCCGGCTCCTCTAGGGCCTATGAATTTAACCTTAGATTCATCTTGTGAATAAACTGATGCTGATAACAAAAAGGCA

ATTCTTAGGACAAGTTTCATTTGCTTATTCCCAAGATTTGCATACCACAGTCATTTTTGAAT
Translation
M - UNI7604 - GRVTYDDVHVNFTWEEWALLDPSQKNLYRDVMLETYRNLAAIG - UNI22126 - GYVWEDHNMEEHLHISRRYGR RHERSHT

EQLLSEFIQCDKAFAFQSHNQRQERIYTAETPYECNQCGKSFARKSHLLRQKRTHTGEKPFQCNQCGKTFARNTHLLQHKKVHTGEKPYECNQCDKASVC

HIGLLYHKRTHAGERPYEWNECGKSFVYHSCIKQCKRRHAGETPFECNQCGKSFARKSNLLRHKRIHTGEKPYKCDQCGKDFASPSSFKCHKRKHTGEKP

YKCDQCGKDFASPSSLQYHKRIHTGEKPYECIQCGKAFARLSILRRHKRTHTGEKPFECNQCGKSFARKSHLLRHKRIHTGEKQHKRTHTGEKSFECNEC

GKSFARKSHLLRHKRIHTGEKPYKCDQCGKDFACPNSLQYHKRVHTGEKPYECKQCGKAFAFSTSLRIHKRRHTGEKPYECNQCDKAFLCPSGLLYHKRT

HTGERPYECNECGKSFIHHSSFRMHKRTHTGEKPFECDQCGKSFAQNTYLLQHKRVHTGEKPYECKHCGKAFAYSNNLQVHIRTHTKYLVW
Transcript ENSMUST00000099259
Sequence
GGTAGAGTGACCTATGATGATGTGCATGTGAACTTCACGTGGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAATCTCTACAGAGATGTGATGCTGG

AGACCTACAGGAATCTCGCTGCTATAG - UNI22126 - GCTATGTTTGGGAAGACCATAATATGGAAGAGCATCTTCATATTTCTAGAAGATATGGA

AG GCATGAAAGAAGTCATACTGAACAGCTGCTCTCTGAGTTTATCCAATGTGATAAAGCCTTTGCATTTCAGAGTCATAACCAAAGACAAGAAAGAATT

TATACTGCAGAGACACCCTATGAATGTAACCAATGTGGTAAATCCTTTGCGAGAAAGAGTCATCTCCTAAGACAGAAAAGAACACATACTGGAGAGAAAC

CCTTTCAATGTAACCAATGTGGTAAAACTTTTGCTCGAAATACTCATCTCCTACAACATAAAAAAGTACACACTGGAGAGAAACCCTATGAATGCAATCA

ATGTGACAAAGCCTCTGTATGTCATATTGGTCTCCTGTATCATAAAAGAACACATGCTGGAGAGAGACCATATGAATGGAATGAATGTGGTAAATCCTTT

GTATATCACAGTTGTATTAAACAATGTAAAAGAAGACATGCTGGAGAGACACCCTTTGAATGTAACCAATGTGGTAAATCCTTTGCAAGAAAGAGTAATC

TCCTAAGACATAAAAGAATACATACTGGTGAGAAACCTTATAAGTGTGACCAATGTGGTAAAGATTTTGCAAGTCCCAGTTCTTTTAAATGCCATAAAAG

AAAACATACTGGTGAGAAACCTTATAAGTGTGACCAATGTGGTAAAGACTTTGCAAGTCCCAGTTCTCTTCAATACCATAAAAGAATTCATACAGGAGAG

AAACCTTATGAATGTATACAGTGTGGTAAAGCCTTTGCACGTTTAAGTATTCTCCGAAGACATAAAAGAACACATACTGGAGAAAAACCCTTTGAATGTA

ACCAATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAAGAATACATACTGGTGAGAAACAACATAAAAGAACACATACTGGAGAAAA

ATCCTTTGAATGTAACGAATGTGGTAAATCCTTTGCAAGAAAGAGTCATCTCCTAAGACATAAAAGAATACATACTGGTGAGAAACCTTATAAGTGTGAC

CAGTGTGGTAAAGATTTTGCATGTCCCAATTCTCTTCAATACCATAAAAGAGTTCATACAGGAGAGAAACCTTATGAATGTAAACAATGTGGTAAAGCCT

TTGCATTTTCAACTAGTCTCCGAATACATAAAAGAAGACATACAGGAGAGAAACCCTATGAATGCAATCAATGTGATAAAGCCTTTTTGTGTCCAAGTGG

ACTCCTGTATCATAAACGAACACATACTGGAGAGAGACCATATGAATGCAACGAATGTGGTAAATCCTTCATACATCACAGTAGTTTTCGAATGCATAAA

AGAACACATACTGGAGAGAAACCCTTTGAATGTGACCAATGTGGTAAAAGCTTTGCACAAAACACTTATCTTTTACAACATAAAAGAGTACACACTGGAG

AAAAACCCTATGAATGTAAGCATTGTGGCAAAGCCTTTGCATATTCTAATAATCTCCAAGTGCATATTAGAACACATACTAAGTATTTAGTATGGTAA
Translation
GRVTYDDVHVNFTWEEWALLDPSQKNLYRDVMLETYRNLAAIG - UNI22126 - GYVWEDHNMEEHLHISRRYGR RHERSHTEQLLSEFIQCDKAF

AFQSHNQRQERIYTAETPYECNQCGKSFARKSHLLRQKRTHTGEKPFQCNQCGKTFARNTHLLQHKKVHTGEKPYECNQCDKASVCHIGLLYHKRTHAGE

RPYEWNECGKSFVYHSCIKQCKRRHAGETPFECNQCGKSFARKSNLLRHKRIHTGEKPYKCDQCGKDFASPSSFKCHKRKHTGEKPYKCDQCGKDFASPS

SLQYHKRIHTGEKPYECIQCGKAFARLSILRRHKRTHTGEKPFECNQCGKSFARKSHLLRHKRIHTGEKQHKRTHTGEKSFECNECGKSFARKSHLLRHK

RIHTGEKPYKCDQCGKDFACPNSLQYHKRVHTGEKPYECKQCGKAFAFSTSLRIHKRRHTGEKPYECNQCDKAFLCPSGLLYHKRTHTGERPYECNECGK

SFIHHSSFRMHKRTHTGEKPFECDQCGKSFAQNTYLLQHKRVHTGEKPYECKHCGKAFAYSNNLQVHIRTHTKYLVW

For any suggestions or comments, please send an email to unitrap@crg.es