Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074736 (OTTMUSG00000015750)
Chromosomal location
Chr 2: 149656524 - 149830128 (+)
Description
predicted gene, OTTMUSG00000015750 Gene [Source:MGI Symbol;Acc:MGI:3702158]
RefSeq_dna
NM_001085521 
RefSeq_peptide
NP_001078990.1 
UniGene
Mm.445136 Mm.330649 
MGI
MGI:3702158 
Uniprot/SPTREMBL
A2ANU3 B1AYD3 B1AYD4 B1AYD5 B1AYD6 
Human Ortholog
ENSG00000101463 (C20orf39)
Omim not available
UniTrap UNI32258
Vector Insertion
Chr 2: 149756779 - 149828912
Public Clones IST11720D10 (tigm) IST11015G5 (tigm) IST10046C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099263
Sequence
ATGGATGGCATCATTGAGCAGAAGAGTGTTCTGGTACACAGTAAGATCAGTGATGCTGGCAAAAGGAATGGCTTAATTAACACCAGAAACTTCATGGCTG

AGAGCAGGGATGGTCTGGTGTCTGTTTACCCAGCACCTCAGTACCAGAGCCACAGGCTAGTGGCCAGTGCGGCACCAGGCAGCCTGGAAGGAGGCAGAAG

TGAGCCTGTGCAGCAGTTGCTGGACCCAAACACTCTGCAGCAGTCCGTCGAGTCCCACTATCGTCCCAATATCATCCTCTACTCAGATGGTGTACTTCGA

TCCTGGGGGGATGGTGTAGCCACTGACTGCTGTGAGACCACCTTCATTGAGGACCGGTCACCCACCAAAGACAGCCTGGAGTACCCCGATGGGAAATTCA

TCGACCTCTCAGGGGATGACATCAAAATCCATACCCTGTCCTATGACGTGGAGGAAGAAGAGGAGTTACAGGAGCTGGAG AGTGACTACTCCAGCGACA

CAGAAAGTGAGGACAACTTCCTCATGATGCCCCCACGGGATCACCTGGGACTCAGCGTCTTCTCCATGCTCTGCTGCTTCTGGCCTTTGGGCATTGCAGC

CTTCTACTTGTCCCATGAG - UNI32258 - ACAAACAAAGCTGTGGCCAAAGGAGACTTCCATCAGGCCAGCACCAGCTCTCGGAGGGCCCTGTTCC

TGGCAGTCCTGTCCATTACTATTGGAACTGGCATCTATGTGGGTGTGGCTGTTGCCCTCATTGCCTACCTCTCCAAAAACAACCACCTGTGAGCTTCCCA

AATGCTGGCATGAAGGAGGGGGAGTCAAGCCAGCTGTACGAGGGCAGAGAAGAGACACCTGTGTGTTACTGTACAGTACAAGTGATTGCCAAACAACTCC

ATGATGCCCTGGAATCTTCTACTCCTGGAGTTCTTTCATTTTTATCCTTCAACTTCATCTTCAGCACTGTGCAGAGCACCAGGCA
Translation
MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLR

SWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELE SDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIA

AFYLSHE - UNI32258 - TNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL
Transcript ENSMUST00000109935
Sequence
GGGGAGGGCAGAGGCGGAGAGCCACGAGCCCAGAAGCAGAGGCGGGCTCCGCACCGCCCCGCGCCCCTCACGCTTCCCGGCTCTCGAGACGCGCGGGCGG

CCGCCTGGGCGCACCAGCCGGGTCACCTTGTCCCGGAG GGAAATGGGTCCTATGGGGCTTGTGTGACCTGTGAATACAGCCTGCTAGCCTGACTCCGAG

CAGGGAGGGAGTCTACCATGGATGGCATCATTGAGCAGAAGAGTGTTCTGGTACACAGTAAGATCAGTGATGCTGGCAAAAGGAATGGCTTAATTAACAC

CAGAAACTTCATGGCTGAGAGCAGGGATGGTCTGGTGTCTGTTTACCCAGCACCTCAGTACCAGAGCCACAGGCTAGTGGCCAGTGCGGCACCAGGCAGC

CTGGAAGGAGGCAGAAGTGAGCCTGTGCAGCAGTTGCTGGACCCAAACACTCTGCAGCAGTCCGTCGAGTCCCACTATCGTCCCAATATCATCCTCTACT

CAGATGGTGTACTTCGATCCTGGGGGGATGGTGTAGCCACTGACTGCTGTGAGACCACCTTCATTGAGGACCGGTCACCCACCAAAGACAGCCTGGAGTA

CCCCGATGGGAAATTCATCGACCTCTCAGGGGATGACATCAAAATCCATACCCTGTCCTATGACGTGGAGGAAGAAGAGGAGTTACAGGAGCTGGAG AG

TGACTACTCCAGCGACACAGAAAGTGAGGACAACTTCCTCATGATGCCCCCACGGGATCACCTGGGACTCAGCGTCTTCTCCATGCTCTGCTGCTTCTGG

CCTTTGGGCATTGCAGCCTTCTACTTGTCCCATGAG - UNI32258 - ACAAACAAAGCTGTGGCCAAAGGAGACTTCCATCAGGCCAGCACCAGCTC

TCGGAGGGCCCTGTTCCTGGCAGTCCTGTCCATTACTATTGGAACTGGCATCTATGTGGGTGTGGCTGTTGCCCTCATTGCCTACCTCTCCAAAAACAAC

CACCTGTGAGCTTCCCAAATGCTGGCATGAAGGAGGGGGAGTCAAGCCAGCTGTACGAGGGCAGAGAAGAGACACCTGTGTGTTACTGTACAGTACAAGT

GATTGCCAAACAACTCCATGATGCCCTGGAATCTTCTACTCCTGGAGTTCTTTCATTTTTATCCTTCAACTTCATCTTCAGCACTGTGCAGAGCACCAGG

CAGCCAGCGTTGCCGATTCTTCCACATGGAAGTTCCAAAGATTCCATCCCAGTGGCTGACCCTGAATGAATTCTATTGGATGGATGACAACCCAGCTCTG

CAGCCTGCCAGTGCCTGGACCAACACCCCATTAGCAATATACAAACAGTTAAAATATGTTTATTTTTTATGGAATATGGTGCAATAGGCAGAATGCAAGA

GACATGTCACCACTAGCTTGTGGCCCGCTTAAATCCTCTATGTGTACCCCATCTTTGTGGCTTCCTTGTCAGAAACAAGTGGGGCTGAGAAGGGAAAGAA

AGCACCTGCTGGGAGATCTTCTGTCTCTGTCCACAGATGGATCCTGCCTGAGAATGCAGAATTAGAGGAGCATAACGCCTGACCTGGCCCTGCTCAGTCC

CAGCACGCTGCCCCAGCTTGGAGCATCAGGCTTCTTGCAGATACCCAGCAATACACATTTGTGGGGCCTCACTAATCTTAAAGGAGAAGAAGCCACAGCT

CCTCGTAAAAACAAACCCAGTGTTTTCCCCCAGGAGCCTGGGGGAAAGGAGCTGTGAAGACACACCAGATGTTTAACTCCTGGACACTCATCCTGGCCAT

GAACACCACTGATGTTGGAGATCCTGGAAATGAGATGGGCCTTACTCTGTCCACTAAATGAATGGCTATTTTCTTGTCATTTTTAAAGTGCAACTCTTGC

TTCATGCTGCTTCAGTTGCCAGATGAATGCTGAGAAATAAGTAATCACAGATGTTTTAATACCATGTCACTGCTGTTTTACGAGTGTTCATTATTTAACA

AAAATTATCTTTTAGCTTGTTTGCTTACGACTTTTCTTTCTGATGAATGGTGATGTTTGGACTCTG
Translation
 MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVL

RSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELE SDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGI

AAFYLSHE - UNI32258 - TNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL
Transcript ENSMUST00000109934
Sequence
GCCCCGCGCCCCTCACGCTTCCCGGCTCTCGAGACGCGCGGGCGGCCGCCTGGGCGCACCAGCCGGGTCACCTTGTCCCGGAG GTTTTGGTGGCTTGAT

GCATGGCCACATCCTTCCTTCACCTGATTCTGAGAGATAATCTGGATTGCCCATTTTGACCCTTTAACAG GGAAATGGGTCCTATGGGGCTTGTGTGAC

CTGTGAATACAGCCTGCTAGCCTGACTCCGAGCAGGGAGGGAGTCTACCATGGATGGCATCATTGAGCAGAAGAGTGTTCTGGTACACAGTAAGATCAGT

GATGCTGGCAAAAGGAATGGCTTAATTAACACCAGAAACTTCATGGCTGAGAGCAGGGATGGTCTGGTGTCTGTTTACCCAGCACCTCAGTACCAGAGCC

ACAGGCTAGTGGCCAGTGCGGCACCAGGCAGCCTGGAAGGAGGCAGAAGTGAGCCTGTGCAGCAGTTGCTGGACCCAAACACTCTGCAGCAGTCCGTCGA

GTCCCACTATCGTCCCAATATCATCCTCTACTCAGATGGTGTACTTCGATCCTGGGGGGATGGTGTAGCCACTGACTGCTGTGAGACCACCTTCATTGAG

GACCGGTCACCCACCAAAGACAGCCTGGAGTACCCCGATGGGAAATTCATCGACCTCTCAGGGGATGACATCAAAATCCATACCCTGTCCTATGACGTGG

AGGAAGAAGAGGAGTTACAGGAGCTGGAG AGTGACTACTCCAGCGACACAGAAAGTGAGGACAACTTCCTCATGATGCCCCCACGGGATCACCTGGGAC

TCAGCGTCTTCTCCATGCTCTGCTGCTTCTGGCCTTTGGGCATTGCAGCCTTCTACTTGTCCCATGAG - UNI32258 - ACAAACAAAGCTGTGGCC

AAAGGAGACTTCCATCAGGCCAGCACCAGCTCTCGGAGGGCCCTGTTCCTGGCAGTCCTGTCCATTACTATTGGAACTGGCATCTATGTGGGTGTGGCTG

TTGCCCTCATTGCCTACCTCTCCAAAAACAACCACCTGTGAGCTTCCCAAATGCTGGCATGAAGGAGGGGGAGTCAAGCCAGCTGTACGAGGGCAGAGAA

GAGACACCTGTGTGTTACTGTACAGTACAAGTGATTGCCAAACAACTCCATGATGCCCTGGAATCTTCTACTCCTGGAGTTCTTTCATTTTTATCCTTCA

ACTTCATCTTCAGCACTGTGCAGAGCACCAGGCAGCCAGCGTTGCCGATTCTTCCACATGGAAGTTCCAAAGATTCCATCCCAGTGGCTGACCCTGAATG

AATTCTATTGGATGGATGACAACCCAGCTCTGCAGCCTGCCAGTGCCTGGACCAACACCCCATTAGCAATATACAAACAGTTAAAATATGTTTATTTTTT

ATGGAATATGGTGCAATAGGCAGAATGCAAGAGACATGTCACCACTAGCTTGTGGCCCGCTTAAATCCTCTATGTGTACCCCATCTTTGTGGCTTCCTTG

TCAGAAACAAGTGGGGCTGAGAAGGGAAAGAAAGCACCTGCTGGGAGATCTTCTGTCTCTGTCCACAGATGGATCCTGCCTGAGAATGCAGAATTAGAGG

AGCATAACGCCTGACCTGGCCCTGCTCAGTCCCAGCACGCTGCCCCAGCTTGGAGCATCAGGCTTCTTGCAGATACCCAGCAATACACATTTGTGGGGCC

TCACTAATCTTAAAGGAGAAGAAGCCACAGCTCCTCGTAAAAACAAACCCAGTGTTTTCCCCCAGGAGCCTGGGGGAAAGGAGCTGTGAAGACACACCAG

ATGTTTAACTCCTGGACACTCATCCTGGCCATGAACACCACTGATGTTGGAGATCCTGGAAATGAGATGGGCCTTACTCTGTCCACTAAATGAATGGCTA

TTTTCTTGTCATTTTTAAAGTGCAACTCTTGCTTCATGCTGCTTCAGTTGCCAGATGAATGCTGAGAAATAAGTAATCACAGATGTTTTAATACCATGTC

ACTGCTGTTTTACGAGTGTTCATTATTTAACAAAAATTATCTTTTAGCTTGTTTGCTTACGACTTTTCTTTCTGATGAATGGTGATGTTTGGACTCTG
Translation
  MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGV

LRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELE SDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLG

IAAFYLSHE - UNI32258 - TNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL
Transcript ENSMUST00000109933
Sequence
GCGGCCGCCTGGGCGCACCAGCCGGGTCACCTTGTCCCGGAG GGAAATGGGTCCTATGGGGCTTGTGTGACCTGTGAATACAGCCTGCTAGCCTGACTC

CGAGCAGGGAGGGAGTCTACCATGGATGGCATCATTGAGCAGAAGAGTGTTCTGGTACACAGTAAGATCAGTGATGCTGGCAAAAGGAATGGCTTAATTA

ACACCAGAAACTTCATGGCTGAGAGCAGGGATGGTCTGGTGTCTGTTTACCCAGCACCTCAGTACCAGAGCCACAGGCTAGTGGCCAGTGCGGCACCAGG

CAGCCTGGAAGGAGGCAGAAGTGAGCCTGTGCAGCAGTTGCTGGACCCAAACACTCTGCAGCAGTCCGTCGAGTCCCACTATCGTCCCAATATCATCCTC

TACTCAGATGGTGTACTTCGATCCTGGGGGGATGGTGTAGCCACTGACTGCTGTGAGACCACCTTCATTGAGGACCGGTCACCCACCAAAGACAGCCTGG

AGTACCCCGATGGGAAATTCATCGACCTCTCAGGGGATGACATCAAAATCCATACCCTGTCCTATGACGTGGAGGAAGAAGAGGAGTTACAGGAGCTGGA

G AGTGACTACTCCAGCGACACAGAAAGTGAGGACAACTTCCTCATGATGCCCCCAC
Translation
 MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVL

RSWGDGVATDCCETTFIEDRSPTKDSLEYP 

For any suggestions or comments, please send an email to unitrap@crg.es