Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074744 (Gm807)
Chromosomal location
Chr 13: 99870661 - 99877535 (+)
Description
gene model 807, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2685653]
Human Ortholog
not available
Omim not available
UniTrap UNI35385
Vector Insertion
Chr 13: 99870781 - 99875932
Public Clones IST14963D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099271
Sequence
ATTCGGACTGCACAGTGGTGTGCATTGCCATGGAAAATGAGCAGTTTTAAGAGAAGGGGACTTTCACCAAAGCTCTCTTCTCGACCGGGAACCCGGGGCC

ACGGGATGTGGAGTTCTTTT - UNI35385 - GTACAGCAGATGCAGGGCGGTGTAGGAGGGAAGCTGGTGCTGGCCTTCCAGCACCATCCTGTGCTG

GGTTGTTTCCAGACCCACTGCCTGCTTTACCCCTCCTTGGCTTAGATCATGGGTGGGACAGAGGAAGGGACATGACACAGAAAAGGACTGTCAGATGACC

ACACAACTTCTATTGCCAGCTCATCTGATATGTGGATCCCAGGTGAGGGACAGAAGGGATGGAAGACAGAGGAAAGAGAAAGCAAGCCTGTGCCTCTTCT

CATATCTGGCAATGTGTCTGGAAGAGATATATGTCTTCTTCATTGTTCTGTCCCTATGGCCATCTTCTCCTCAGGGTCTAAACTACTGCCACATGCTGTC

CCCTTCCTGTGGCACCCACTTTACAAGTGAAGTCAACTTGCTCATGGAAGACACCATCTGCCTCAGGGCTTTGGTCCCTGGTGCATGAACAGTCTGTGAT

CCAAGGCAGCTGGAAAGCTGAGGCTCCCAGAAGCACCTGTAACTCCAAAGGTCTAGCTCTCTTACTCCTCGGGGTATGATGACCCAAGCTATGTTCCCCA

GTGGCTCTTGGGTACCCGACCAGGCCATGGCTGAGCTTGGCAATACATCTTCCCATAGACTTCCTGGCCACACCTGGCTCGCTGCCCTCCATTTGTGTCC

CTGGCTTCACTTTCCTCAGAGCTGCTGTGCTCCAACCTTGTCTCTTGAGCTTCTGGAAAGCCATGTAATCTACTCTCTGTATTAACTGCTCTCCAGGACT

CCATCTCCACTCGGCTCAGGCCCACCTATCTACCTTCTCAGAGAGGAAGAAGATGCCTGCGGAGTCACTGCTCCTCAAAGCATCCTTCATGTTTCTCTGC

AGCCCATTCTGAAGTGTGGGCTGTGGAGGCTGGCCCCTCTTGCCTCAGACGTAAGACTCTTGGTGCTGCTCCCCTACTGCGAAACCTTCTGTAAGGGCTG

ACATGACACCTACCTCTGTACCCTCACTGACTTGTGCTGATTTGCTTTAGCCAAACTTCCTGGCCAGAGGCAGAGAGAAGGTCATTGCCTTCATACCTCA

TGGTCCTCTGTTCTCTGCCCATGGGCAATGGTGACGTGAGCTGAAGATCCCAGAAAAGAAAGGCATGTTTAAGTTAAAGTGTCTACAAGGCTCATTGATT

AGAACTTTGTGATTGTGGGGAACTGGAATGTTACAGATCCAGAGCCAAATTATCTTGGGATATTCTTATTCCCATTGCTAGCTGTTCATTACCTCTGTGT

CTGACTTAACTTGTGACTATGACAGGAAATATTTTGGGACATATTAACTCAACATCTCACTATATTCTATGAGCCCTAGAGCCAAGGATATCATTAGACA

GCATTTGAAACATAGATCAGAGATTTCCCTGTTCTGCGGAAACCACCAACCTGGTGCTTCTACCAATGCATTTGGAACAAGCCTTAACTTATGTCTCTTT

TTATCCTGTAACACGTATAAAAGCTTCACAAAACTGTTTCCCCACTGGAGCACGGCATTTGTGGTACCCTGAATCTGTGTTCCTGGGCCACAGTCACTCA

TATTTGGCTCCAGAATAAACTTTCTTATTTCCTCTGT
Translation
 - UNI35385 - MTTQLLLPAHLICGSQVRDRRDGRQRKEKASLCLFSYLAMCLEEIYVFFIVLSLWPSSPQGLNYCHMLSPSCGTHFTSEVNLLMED

TICLRALVPGA

For any suggestions or comments, please send an email to unitrap@crg.es