Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074758 (EG433481)
Chromosomal location
Chr 2: 143998886 - 144015026 (-)
Description
predicted gene, EG433481 Gene [Source:MGI Symbol;Acc:MGI:3645019]
UniGene
Mm.330630 
MGI
MGI:3645019 
Uniprot/SPTREMBL
Q3UMU7 
Human Ortholog
not available
Omim not available
UniTrap UNI31605
Vector Insertion
Chr 2: 144004763 - 144015027
Public Clones IST13124D2 (tigm) IST10249H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32595
Vector Insertion
Chr 2: 144000262 - 144004885
Public Clones IST10066G12 (tigm) IST11408C12 (tigm) IST12387H12 (tigm) IST12838G3 (tigm)
IST10713F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099292
Sequence
TGACCTATTCAACTCCTCACCAGTCAGCTGCTGTGGCCTCTCTGTTTCCCTCCCTAGGACTCTCAGGATTCCTTCCAAAGAAAGGGAATGGACTCCAATC

CTGGGCTGGGTCTGCTTCTGTAACAAGATCTGCATGCCATTTTGATAAAG - UNI31605 - - UNI32595 - CCTGAATCAACCTGGAAGCAGAT

TCCTCCCTGTCACAGTTCTGCCGAGACCACAGTCCCACAATGCTTTGCACAGCCAGAAGACCCAAGCCCAGTTGGCCTCACAGAAATGGTGACACAGG -

 UNI31605 - - UNI32595 - GCTTTGGACTTCTGCCAGTTCTCCTGTAGGAAGCCCAGACTACCATGCTTACACCATCCTGCAGAGAGCCACATT

GTGGGAAGCAGAGACGCACCATTTCTCACCAGTGATCCCAGACCAGCTAGTCCACAAGAGCCCAGTAACAGGCCAAAGATACCCAAGTGAGTCAGCTGGG

AGCAAAGGAGTCACCCAGCCAAGCCCGACCTGCATGGCTGATT - UNI32595 - GTCTGTTTGTGGTCCTGGCTCTCCTGGCTCCCGAGATACAGAT

CAACTGGCCTCGAACTCACGGAGATCCTACTGCCTCTGCCTTCTAGTGTTGGGATTAGAGGTATGTGTCACCATGCCTAGCCCATCCTTGTACTTATTAG

GAGTTTAGCTTCTGGCTGGATTACCCATCTCAGAGTGAAGTAAAGATGGCAGCTTGTTCTCTACTGTCAGACAAGGACTTTAGCAAAATCGGCCCCCCCT

AGCTCCAGTCTTCTGGAAGATTCTTACCACACCCTAAAGAGCCCACAGGAACCCTGACATGTTTAAATTGCTGACAAGGTGGGTGTGGAGGAAGCAGCTA

TAATGAAGAAGAAACCTTTCTTCTACAAGAAAGAGAAACCTTAGGCTCTTGCTGAGACAACAGGGAAGGAGCCCAGAGAGCAGGATCCCATGGAAGAGTC

ACACAGGATGTGGACACTGATCAGACCTGACCTGGCCTGGTCTTTGACTTTGCCTGTGTCATCACGCCTGGGGTTGGAACTGCCCCACCCCCACCCATGA

AGACTCCGTCGCCCTTTCCAGGAAATGTACAGACAAGAGCAGGAAACTGTTGAGTCGCCTATTTTTCTTTCCCTGCAAAATGGTTTTATTATTTTCGTTG

AACAAAAACATCCTAATGTATTGAGGATGGAGAAGAGAAAGACACCCAGACCTTAAAATAGACTCAATACGCCTGTACTTTTGGCTGGAGCATCCTTGCC

TGTATCCTGGGAAAGGATATCTGAAAAACTGGAACTCCACCCATTCTGCCCTCTAGGTTTGAGCTGTCGAAACTCCCTGGTGGCAAAAGGGCACTCTAGA

TCAGGGGAAGCAGCCTTCGAAACAGCCTTGTGGCTGCTCTGGGGGGCCCTGTGGTTTCTCTTTAGCCATCTGGGGGACCTTGAGTAAATGACCCAACCCC

TCTGATAGTCTGTGTAACATGGGGAAGACAAGAGAGTTCTATCTTCCTACTCTCTTCCTTTGCTCTCTCCCTTATCCATAGGCTGTTTCCCACAAGTCTG

AAGGCACCAGTGCTACAGATGGAGGTGTGTGTAAATTTGGTTCCATTGCTGCGTACCCACTGTGATAACATGGATGCAGTGATGGTACCACACTCAGATG

GTGCCACAGTTTATATATGTGTCTGTATGCATAATATAATGTGTGTGTATAATATATGTATGCATATACACATCTACTATCTATCTATAGATAGATAATA

TGCATATGCTC
Translation
 - UNI31605 - - UNI32595 - MLCTARRPKPSWPHRNGDTG - UNI31605 - - UNI32595 - GLWTSASSPVGSPDYHAYTILQRATL

WEAETHHFSPVIPDQLVHKSPVTGQRYPSESAGSKGVTQPSPTCMADC - UNI32595 - CLFVVLALLAPEIQINWPRTHGDPTASAF

For any suggestions or comments, please send an email to unitrap@crg.es