Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074796 (Slc4a11)
Chromosomal location
Chr 2: 130509850 - 130523208 (-)
Description
solute carrier family 4, sodium bicarbonate transporter-like, member 11 Gene [Source:MGI (curated);Acc:Slc4a11-001]
RefSeq_dna
NM_001081162 
RefSeq_peptide
NP_001074631.1 
UniGene
Mm.404246 Mm.441391 
MGI
MGI:2138987 
Uniprot/SWISSPROT
A2AJN7 
Uniprot/SPTREMBL
A2AJN8 
Human Ortholog
ENSG00000088836 (SLC4A11)
Omim 217400 - CORNEAL DYSTROPHY AND PERCEPTIVE DEAFNESS  
UniTrap UNI17412
Vector Insertion
Chr 2: 130517815 - 130517901
Public Clones not available
Private Clones OST443317 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099362
Sequence
TCCAGTGAGTGTCCCTGCACTGCTCTGAAACTTCGTAGTCCCTCCCAGGCCGGCACCCCACGACTCTCAGGCCTGCGCACGCGAGCCGCCGAGGATCCAG

AACAGACCTCGCGG GCCCATCCTCCCGTGCGTCCTTCTTTGCACAAACATCTCGGATAGTACCTCCAATCTCTGTGTACTGCACACCCACTCTACCCCT

TCTTTCCGGCATCGCAGGACACG AAAACTGTCCTTGGGCCATGTCACAGAATGAACACTGTCAGGACTCCGGTGAATACTTCTCAG CCGGCACTCAGG

GATACTTCAAGAACAACATGGAGGATAACCTTGAAGTCCGGGAAGACAGCCTAGGGGATGAGGTCTTTGACACCGTCAACTCCTCCATTGTGTCTGGCGA

GAGCATCCGGTTTTTTGTCAATGTCAACCTTGAAGTGCAGCCCTCCAAATCTG - UNI17412 - ACTTAGAAGCTGCAACGGGTGGCTGCGTGCTCT

TACACACCTCTCGCAAG TATCTGAAATTGAAGAACTTTGAGGAAGAGGTCCGTGCACACCGGGACCTGGATGGCTTCCTGGCCCAGGCCAGCATCATCC

TGAATGAGACAGCTACCTCACTGGATGATGTCCTCCGAACTATGCTAAACCGCTTTGCCCTGGACCCTAACCACGCAGAACCTGACTGTGACCTGGACCT

GCTCATGGCTAAGCTCTTTACAGATGCTGGAGCCCCTATGGAGAGCAAGG TCCACCTGCTGTCAGATACCATCCAGGGAGTCACTGCCACTGTCCGAGG

GGTGCAGTACGAGCAGTCTTGGCTCTGCATCAT CTGTACCATGAAGACCCTACAGAAACGGCATGTGTGCATCAGCCGCCTGGTTCGACCACAGAACTG

GGGGGAGAACTCCTGTGAGGTTCGCTTTGTCATCCTGGTGCTGGCCCCACCCAAGATG AAAAGCACCAAGACTGCAATGGAGGTGGCACGCACCTTTGC

CACCATGTTCTCAGACATCACCTTCCGCCAGAAGCTCCTGAAGACTCGCACAGAGGAAGAATTCAAGGAGGCTCTGGTGCATCAGAGACAGCTGCTCACC

ATGATGATGCCAAGAGCCGCAGGGCACAGCATGAGCTCCCTCCATACTCACAGACACCCTCAG CCCCCGAAATGCAAGGACTTTTTCCCTTTTGGAAAG

GGCATCTGGATGGATATCATGCGCAGGTTTCCTGTGTACCCAATGGACTTCACTGATG GCATCATTGGGAAAAGCAAGAGCGTGGGCAAATATGTCACC

ACCACACTCTTCCTCTACTTCGCCTGCCTCCTACCGACCATTGCTTTTGGATCCCTCAACGATGAGAACACAAACGGGGCCATCG ATGTGCAGAAGACC

ATAGCTGGACAGAGCATCGGAGGCCTCTTGTATGCACTGTTCTCTGGGCAGCCCCTGGTGATACTGTTGACAACCGCACCCCTGGCCATCTACACCCAGG

 TGATTCGAGTCATCTGTGATGACTACAATCTGGACTTCAACGCCTTCTATGCATGGACGGGCCTGTGGAACAGTTTCTTCCTTGCACTTTATGCCTTCC

TCAACCTCAGCCTGCTTATGAATCTCTTTAAGAG GTCTACAGAGGAAATCATTGCTCTGTTCATTTCCATCACGTTTGTGCTGGATGCTGTCAAGGGCA

TGGTCAAAA TCTTCGGGAAGTACTACTATGGTCACCACTACCACACAAAAAGGACTTCCTCCTTGGTGAGCCTGTTGGGCATTGGCAGAAGCCCCAACA

GCAGTCTCCACACTGCACTCAACGCCAGCCTCTTGGCCAGCCCCGTAGAGATGGCCACAACCAGCAGCCCCGGCAGCACACACTCGGGCCAGGCTACAGC

GGTGCTCAGCCTCCTCATCATGTTGGGCACACTCTGGCTAGGCTACACCCTCTACCAGTTCAAGAAAAG CCCCTACCTGCACCCATGTGTGCGTGAGAC

CCTGTCTGACTGTGCCCTGCCCATCGCCGTGCTCTCCTTCTCCCTCATCGGCTCCTATGGCTTCCAGGAAATTGAGA TGAGCAAGTTCCGGTATAACCC

CAGCGAGAGCCTTTTTGAGGTGGCACAGATCCACTCTCTGTCCTTCAAGGCCATCGGCAGTGCCATGGGTCTTGGTTTCCTGCTCTCCTTGCTTTTCTTC

ATTGAGCAGAACCTGGTGGCGGCCCTGGTCAATGCACCAGAGAACAG GCTGGTGAAGGGCACTGCCTATCACTGGGATCTCCTGCTACTTGCCATCATC

AATACGGGGCTGTCTCTGTTTGGGCTACCCTGGATCCACGCCGCCTATCCCCACTCCCCTCTGCATGTGCGGGCACTGGCCTTAGTGGAGGAACGCGTGG

AGAATGGGCACATTTATGAAAC GATTGTGGATGTTAAGGAGACTCGGCTGACGGCGCTGGGTGCCAGTGTCCTGGTGGGCCTGTCCTTGCTGCTGCTGC

CATTCCCTCTGCAGTGGATCCCCAAGCCTGTGCTGTATGGGCTCTTTCTGTACATTGCACTGACCTCCCTGGACGGCAACCAGCTCTTCTCGCGTGTGGC

CCTGCTGCTCAAGGAGCAG ACATCATACCCACCCACACACTACATCCGGAGAGTGCCCCAAAGGAAGATCCACTACTTCACAGGCCTGCAGATCCTGCA

GCTGCTACTGCTCTGTGCCTTCGGCATGAGCTCCCTGCCCTACATGAAGATGGTCTTTCCCCTCATCATGATTGCCATGATTCCAATCCG CTACAATCT

GCTACCCCGAATCATTGAGGCCAAGTACTTGGATGTCATGGATGCTGAGCATAGGCCCTGACCTGCGCCACCCCCCCCCCCATTCTTCAGGCCTGCTCTG

TGGCAACATATGGGGAGGTATGAGCTGGCTGTGGCTCTGGCCCATCCTCATTGCTGTCTTATAGCCTAAAGGCCCTTGGCACTGTGGTTTTCAAAGGTGT

GTGCTCACTCCTCACCCTGTTAACATTCAGTTTGGGGTCAGAAACACTGTCGGGTGGGGCTAAGAAGAGTGGATATTCTTTTGATAAAAGAGTTGATGCC

CAGGAGAGAGCCCATTTCCTTGATTGTATAAGGAACTCAGTTGTGCACATTAGTGAATAAAAGTCTTGTTTCTATGCTTTC
Translation
  MSQNEHCQDSGEYFSA AGTQGYFKNNMEDNLEVREDSLGDEVFDTVNSSIVSGESIRFFVNVNLEVQPSKSD - UNI17412 - DLEAATGGCVL

LHTSRK YLKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNRFALDPNHAEPDCDLDLLMAKLFTDAGAPMESKV VHLLSDTIQGVTAT

VRGVQYEQSWLCII ICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKM KSTKTAMEVARTFATMFSDITFRQKLLKTRTEEEFKEALVHQ

RQLLTMMMPRAAGHSMSSLHTHRHPQ PPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDG GIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNG

AID DVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQV VIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKR RSTEEIIALF

ISITFVLDAVKGMVKI IFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSPGSTHSGQATAVLSLLIMLGTLWLGYTLYQ

FKKS SPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEM MSKFRYNPSESLFEVAQIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENR

 RLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGHIYET TIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLY

GLFLYIALTSLDGNQLFSRVALLLKEQ TSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIR RYNLLPRIIEAKYL

DVMDAEHRP

For any suggestions or comments, please send an email to unitrap@crg.es