Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074865 (6720457D02Rik)
Chromosomal location
Chr 13: 62618860 - 62659989 (-)
Description
RIKEN cDNA 6720457D02 gene Gene [Source:MGI Symbol;Acc:MGI:1924367]
MGI
MGI:1924367 
Uniprot/SPTREMBL
Q8BSR1 
Human Ortholog
not available
Omim not available
UniTrap UNI2143
Vector Insertion
Chr 13: 62621905 - 62659846
Public Clones XR1000 (sanger) AN0560 (sanger) AB0076 (sanger) IST10890H9 (tigm)
IST10611G8 (tigm) IST15081D4 (tigm) IST14374H11 (tigm) IST14732H8 (tigm)
IST11324D11 (tigm) IST15063F5 (tigm) IST10092A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000082203
Sequence
GAGGCGTGTTCTTCCGTGTGCCTTGTTCCCCTGCTCTCTGTTCCTCTCCGTTGCGAGCAAGCTGAAAGATTGGTCTGATGTGTTTTGATCTCTGCTGCCA

GGGACCCTAGGGCAATGCCAGCGATCTACAACGTGGCGACATG - UNI2143 - AATGCAGTGACTTATGAGGACCTGCATGTGAACTTCACTCAAGA

GGAGTGGGCTCTGCTGGATCCTTCTCAGAAGAAGCTCTACAAACATGTCATGCTGGAGACCTACAGGAACCTCAATGCTATAG GCTTTAATTGGGAAGC

CCAAAATATTGAAGAACATTGTCAAAGTTCTAGAAGACACAGAAG GTGTGAAAGGAGTCAGAGTGCAGAGAAACCCTCTGAATATACTCAACGTGATAA

AGCCTTTGCTTTATCTGCTCACAGTCATGCCCAAAGGCATGAAAGGATTCATACAGAAAAGATCCCCTCTGAAGATATTCACTGTGTCGAAGACGTTTTA

CCTTACACTAGTCTCCAAGTACATAAAAGAACACAAACTGGACAGAAACCCTATGAATGTAAACAATGTGGTAAAGGATTTGCAAAGCCCAGTCATCTTA

AAAGGCACGAAAGATATCATACTGGAGAGCAACCCTTCACATGTAATGAATGTGATAAAGTCTTTTCTTTTAAACATCATCTCCAAACACATATAAGCAT

ACGTACTGGAGAGAAACCCTTCAAATGTAATCTGTGTGATAAATCCTTTTCAAAACATAATCATCTTCAAAGTCATAGAAGAACACATACTGGAGAGAAA

CCCTACAAATGTGATCAATGTGATAAAGCCTTTTCTGAGAAATGTAATCTCCAAACACATATAAGGATACATTCTGGAGAGAAACCCTACAAATGTGATC

AATGTGATAAAACCTTTTCTGAGAAATGTCATCTCCAAAAACATATAAGGATACATACTGGAGAGAAACCCTACAAATGTAATCAATGTGATAAAGCCTT

TTCTCAATACAA TACTCTTCAAACTCATAGAAGAACACATACTGGAGAGAAACCCTACAAATGTAATCAATGCGATAAAGCCTTTTCTCAATACAGTAA

TCTTCAAACTCATAGAAGAACACATACTGGAGAGAAACCCTACAAATGTAATCAGTGTGATAAAGCCTTTTCTATGAAATGTAATCTCCAAAACCATGTA

AGGATACATACTGGACAAAAACCCTTCAAATGTAATCAATGA
Translation
 - UNI2143 - MLETYRNLNAIG GFNWEAQNIEEHCQSSRRHRR RCERSQSAEKPSEYTQRDKAFALSAHSHAQRHERIHTEKIPSEDIHCVEDVL

PYTSLQVHKRTQTGQKPYECKQCGKGFAKPSHLKRHERYHTGEQPFTCNECDKVFSFKHHLQTHISIRTGEKPFKCNLCDKSFSKHNHLQSHRRTHTGEK

PYKCDQCDKAFSEKCNLQTHIRIHSGEKPYKCDQCDKTFSEKCHLQKHIRIHTGEKPYKCNQCDKAFSQYN NTLQTHRRTHTGEKPYKCNQCDKAFSQY

SNLQTHRRTHTGEKPYKCNQCDKAFSMKCNLQNHVRIHTGQKPFKCNQ

For any suggestions or comments, please send an email to unitrap@crg.es