Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074876 (Spata5l1)
Chromosomal location
Chr 2: 122456422 - 122459483 (+)
Description
spermatogenesis associated 5-like 1 Gene [Source:MGI Symbol;Acc:MGI:3036261]
UniGene
Mm.271306 
MGI
MGI:3036261 
Uniprot/SPTREMBL
Q3TER3 
Human Ortholog
ENSG00000171763 (SPATA5L1)
Omim not available
UniTrap UNI2355
Vector Insertion
Chr 2: 122458441 - 122459459
Public Clones AD0326 (sanger) AD0574 (sanger) RRN178 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099458
Sequence
ATGGCTCCGGACTCGGGGCCCTTCCCCGACGGACAACTTTTGAAGCTGCTGCCGGTGGATCCCCGGGACCGGGACACCCAGCGCTGCCGCCTGGGGCCGG

CCGCCTTCCGCAGCTTGGGTGCGCGCCTGGGCTCGCCGCTGAGGATCTCGTTGCCCGCCGGCGGCTGCTGCCTCTGCACGGCCTGGCCGCGGCGCGACAG

GGTGGATGGCTTTGTGCAGCTGGACCCGCAGTGCGCTAGCCCCGGGGCCCGGGTGGCCACGGGGAGGATAGGTATGGACTGCTTGCAACCCGTGCCCTGT

CCGCCCCTGCGGCGCCTAGAGGTGTGGCCGGTGCTGCGGCCCCAGGCGGGAGCCCCGAGTTCCGCCGCGGTGCTGGAGGTAGTGCACGAGCTGCTGCGCA

ACCGGCCTGTGTCTCGGGGACACGTGGTGACCACCCCGCCGGGTGTCCCCGGCCCTGTCGCAGCTCTGCACGTGATGGGCGGGACACCGGACCCAGAGCC

CGGCGGGTGGGTCACACCGCATACCCGCATCACGCTCAGTGACAAGCCTCCGCCACAGGTCGAGCCTCCCGGGGAGGTGACCCTTGGGGGTCTGTCGGAG

ACCGCCGACTCCCTACGGGAGCTGCTCCGCCTGCCGCTGCGCTACCCGCTCGCCCTAGCCGCGCTGGGGCTGGCTGTGCCCCGCGGGGTGCTCCTGGCGG

GCCCCCCGGGAGTGGGCAAGACCCAGTTAGTGCGGGCCGTGGCGCGCGAGACTGGCGCCGAGCTGCTGGCGGTGAGCGCCCCGGCGTTGCAGGGCTCCCG

GCCCGGGGAGACCGAGGAGAACGTGCGGCGCATCTTCCAACGAGCCCAGGAGCTGGCCAGCCGCGGACCCAGCCTCCTCTTCCTGGACGAAGTGGATGCC

CTGTGTCCCCGGAGAGGCGGCCCGCACCGAGCTCCCGAGAGCCGAGTGGTGGCCCAGGTGTTGACGCTGCTGGACGGCATCCACAGGGACAGGGAGTTTG

TGGTTGTGGGAGCCACCAACCGGCCAGACGAGTTAGACCCAGCGCTTCGCAGGCCGGGCAGGTTTGACAGAGAG GTTGTCATTGGAACTCCCACCCTTA

AACAAAGAGAAGCAATTCTGCAAGTGATTACTTCAAAGATGCCCATCTCCAGTCATATTGATTTAGGTCTCCTGGCAGAAATGACGGTTGGCTATGTTGG

TGCTGACCTGACAGCACTCTGTAGGGAGGCTGCCATGTGTGCCCTTCTCAAGAATGAGAAG - UNI2355 - TATCACGGATGGAGACGTGCTCTC
Translation
MAPDSGPFPDGQLLKLLPVDPRDRDTQRCRLGPAAFRSLGARLGSPLRISLPAGGCCLCTAWPRRDRVDGFVQLDPQCASPGARVATGRIGMDCLQPVPC

PPLRRLEVWPVLRPQAGAPSSAAVLEVVHELLRNRPVSRGHVVTTPPGVPGPVAALHVMGGTPDPEPGGWVTPHTRITLSDKPPPQVEPPGEVTLGGLSE

TADSLRELLRLPLRYPLALAALGLAVPRGVLLAGPPGVGKTQLVRAVARETGAELLAVSAPALQGSRPGETEENVRRIFQRAQELASRGPSLLFLDEVDA

LCPRRGGPHRAPESRVVAQVLTLLDGIHRDREFVVVGATNRPDELDPALRRPGRFDRE VVIGTPTLKQREAILQVITSKMPISSHIDLGLLAEMTVGYV

GADLTALCREAAMCALLKNEK - UNI2355 - YHGWRRAL

For any suggestions or comments, please send an email to unitrap@crg.es