Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074911 (AC131691.4)
Chromosomal location
Chr 16: 91689143 - 91712198 (+)
Description
Putative uncharacterized protein  [Source:UniProtKB/TrEMBL;Acc:Q3TUQ9]
Uniprot/SPTREMBL
Q3TUQ9 
Human Ortholog
not available
Omim not available
UniTrap UNI33229
Vector Insertion
Chr 16: 91689526 - 91709022
Public Clones IST12322D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26762
Vector Insertion
Chr 16: 91709136 - 91710079
Public Clones not available
Private Clones OST98960 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114029
Sequence
GGCCGGGCGCGCGCAGCTCGCGGCTCTCCTGCTGCGAGGTCGGCGTCGCTGAGAACGCGACGGCGGCGCGCGGCACCCGGTAGGGCTCGGAAAAGGGATT

AACAGTACCAACTCGGCAGCGGGCGTAGTGTCAGCCCCGGGTACGGAGCATGAATGCACAGCAAACAACACATTGATTGGTGGTGATGGGCAGTTACTTC

TCTCCGTGAGAAGCCGCAATATCATTCTGAGAGAGACGGTGATGGGCCGAGCTCAACACAGTACCCACGAGGGGGAAATGTCCGCCAGCTTCAGGCTAGC

CGCAGGCCAACTCTTCCACCCTTGTCCCCAGTGCCCGACCACCGCAGCCCTCTATGCAAATGCCGTCACTACTACAGGACCAG - UNI33229 - AAG

AAAGACAGCTGACGACAGAGGACTGAGGACCTGGGCACCACCACTTACCGACCACTTCGTCGTCTGGCTGAAAGAACGTTACCTTCCTGCCAACTAAAGA

GCAGAAATAG - UNI26762 - TCTACAGATAAGGAAAACGAAGTAAAATGGCCTCATAATCAATTCATCCTTTGGTACCAAGATA TGTACACACGG

ACAGCTCTCAGACGGAATCCTAGCTGCATAGAGTGCTCATCCTGCCAAATCAGCCCAGGCTCTGCTCACTAGTGATTCCACACACTAGCAATTCCACACG

 GGCTGGTGAGATGGCTCAGTGGGTAAGAGCACCCGACTGCTCTTCCGAAGGTCCGGAGTTCAAAACACAGCAACCACATGGTCGCTCACAACCATCCGA

AACAAAATCTGACTCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTATTTACATATAATAAATAAATAAATCTTTTAAAAATGACCTTTTAATAAAT

TTATATT
Translation
 - UNI33229 -  - UNI26762 -   MAQWVRAPDCSSEGPEFKTQQPHGRSQPSETKSDSLFWSV

For any suggestions or comments, please send an email to unitrap@crg.es