Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075007 (AC144776.2)
Chromosomal location
Chr 16: 57353390 - 57515803 (+)
Description
FIL1L_MOUSE Isoform 2 of Q6P6L0 - Mus musculus (Mouse) [Source:UniprotKB/SpliceVariant;Acc:Q6P6L0-2]
Human Ortholog
not available
Omim not available
UniTrap UNI30685
Vector Insertion
Chr 16: 57353572 - 57506711
Public Clones (sanger) IST11771G9 (tigm) IST11979F3 (tigm) IST14279G8 (tigm) IST12377A11 (tigm)
IST10949D8 (tigm) IST14291C12 (tigm) IST14601D11 (tigm) IST14238E9 (tigm)
IST10416H2 (tigm) IST14749A11 (tigm) IST11628A9 (tigm) IST10557F12 (tigm)
IST14639E11 (tigm) IST10060D7 (tigm) IST15082A8 (tigm) IST10187C8 (tigm)
IST10697D2 (tigm) IST11751F8 (tigm) IST10067F8 (tigm) IST13756D10 (tigm)
IST13837G6 (tigm) IST12656D3 (tigm) IST14989G6 (tigm) IST13858H12 (tigm)
IST10020D4 (tigm) IST12345C7 (tigm) IST14006C9 (tigm) IST14283A1 (tigm)
IST11161C1 (tigm) IST11431D1 (tigm) IST13421H9 (tigm) IST14736G9 (tigm)
IST12538H4 (tigm) IST12715E12 (tigm) IST10060C7 (tigm) IST10536B8 (tigm)
IST13740G8 (tigm) IST12371H4 (tigm) IST14439D10 (tigm) IST13518E1 (tigm)
IST11058H8 (tigm) IST13087A7 (tigm) IST12530A12 (tigm) IST14165G8 (tigm)
IST14518E5 (tigm) IST10413H2 (tigm) IST14741D7 (tigm) IST14233A3 (tigm)
IST10119E2 (tigm) IST11570E5 (tigm) IST12135D11 (tigm) IST15077F9 (tigm)
IST11138G3 (tigm) IST11590A2 (tigm) IST10798E12 (tigm) IST11093F7 (tigm)
IST13368C2 (tigm) IST12751C11 (tigm) IST14916G12 (tigm) IST14724C4 (tigm)
IST11522G9 (tigm) IST12654A4 (tigm) IST10717F12 (tigm) IST12657G11 (tigm)
IST10301D9 (tigm) IST10076H8 (tigm) IST10067G8 (tigm) IST10633D5 (tigm)
IST12362C2 (tigm) IST11200B2 (tigm) IST11373A8 (tigm) IST12942H11 (tigm)
IST11932H11 (tigm) IST13744A6 (tigm) IST10204B2 (tigm) IST10533B4 (tigm)
IST11814F5 (tigm) IST14676F2 (tigm) IST10232E12 (tigm) IST10852A9 (tigm)
IST13788B5 (tigm) IST10781D6 (tigm) IST11068G12 (tigm) IST11365A4 (tigm)
IST10146B10 (tigm) IST14849C10 (tigm) IST12233D6 (tigm) IST14190H2 (tigm)
IST14745A8 (tigm) IST15077G3 (tigm) IST10046F9 (tigm) IST13870F10 (tigm)
IST10481E5 (tigm) IST13210C2 (tigm) IST13941C4 (tigm) IST10219E12 (tigm)
IST11053F7 (tigm) IST11715A10 (tigm) IST12147D7 (tigm) IST14973B12 (tigm)
IST13160E1 (tigm) IST10235C6 (tigm) IST11197F8 (tigm) IST11797C12 (tigm)
IST10597A9 (tigm) IST11165E1 (tigm) IST10443C6 (tigm) IST10101A6 (tigm)
IST10524D3 (tigm) IST14243B8 (tigm) IST10013B11 (tigm) IST14245A4 (tigm)
IST14432G8 (tigm) IST12123A6 (tigm) IST13194E9 (tigm) IST12370A4 (tigm)
IST14752G4 (tigm) IST13787A11 (tigm) IST11267C10BBF1 (tigm) IST13999A8 (tigm)
IST14931B11 (tigm) IST10119D1 (tigm) IST14737H4 (tigm) IST10626D8 (tigm)
IST10345F4 (tigm) IST10700C5 (tigm) IST10228F10 (tigm) IST14982H4 (tigm)
IST10720H12 (tigm) IST11994G11 (tigm) IST10995H1 (tigm) IST13670E8 (tigm)
IST12337D10 (tigm) IST11223F1 (tigm) IST12363B2 (tigm) IST10236A10 (tigm)
IST11304B10 (tigm) IST12377A12 (tigm) IST13434D6 (tigm) IST14019G12 (tigm)
IST14771B1 (tigm) IST11245F10 (tigm) IST14981G2 (tigm) IST13973E7 (tigm)
IST13436D11 (tigm) IST12519B8 (tigm) IST11942H8 (tigm) IST14850D11 (tigm)
IST12418E11 (tigm) IST10554D12 (tigm) IST13641C7 (tigm) IST10303B8 (tigm)
IST14121H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099667
Sequence
GTAGAACCGTCCCTGGTCCCTGGTTACATACTCTCCGTGACTTTGAGACCCACAAGGCAAATAGCGAGAGGGTGCCCAAAAAGAAAAGAAAACGCTTTTG

GGTGCTCAGGCTCCACTGCTGGATTTCGACAGGCATCAGAAGAGAGAACGGCCAGGCGTGATGAAGCCCAGGTACCTGCATG - UNI30685 - TCCT

TGAAGAATGCGTTCCAGAAGCAGCAATGCTGAGGGCTCAGCCCCAAAGCAAATCCCAAGACATAGCAAATTCCAGGACAGTATCCAGGACATGAAGCACA

GAACACACAAAAAAGACCCCTCGTGTGAGTCAGAAGGGGTCCTTCCACGTCCCGTGTCAGAGAAGTCACACACTGGCAAAGGCCACCACACAGAAGACCT

CTCAAGAGATGACTTACTATTTCTGCTCAGCATTCTGGAGGGAGAACTGCAG GCTCGAGATGAAGTCATTGGCATTTTAAGGGCTGAAAAAATAGACCT

GGCTTTGCTGGAGGCTCAGTATGGGTTTGTCACTCCGAAAAAGGTGTTGGAGGCTCTCCAGAGAGATGCTTTTCAAGCAAAATCTGCCCCGTGGCAGGAG

GACATCTATGAGAAACCAATGAATGAG TTGGATAAAGTCGTAGAAAAGCATAAAGAATCTCACAGGCGGATCTTGGAACAACTCTTAATGGTAGAAAGA

TCCCACCGGCAAACCATAATGGAGATGGAGGAAGAAAAGAGAAAACACAAAGAATATATGAAGAAGAGTGATGAATTCATAAACTTATTGGAGCAGGAAT

GTGAGAG AATATAAACTCTTAAAGGATAATCAAACTGAACAGACATGATGAGGTCAGACTGTGGCATACTCCTTGCTTAGCCATTCACCCATTTCTACT

GTAAAGGAAAAGCTTCCAGATGGAACCATTTGGGTGTGAGAATGTCACACTTACTCTCAACTCACACAACACAGAGTTTTCTTCCTTTGCTTCGCTTGTA

TGTACAATCCCTGTCTCTTGTCACTGTTGGTACATTCCCTTCAACACTTGCTCCAGCCTGCTTCAAGAAAGGCTGCAAGCCTCATGTGGCATGACTGACA

TCCACCTACTTTAAGGCCATGAACACCACCCGACAAAACAGAGCATGGAAGAGACTCCGGTGGGAGGAACCCGGGTGGTTTCAATTCAAGACACATGCAG

AGGTACTTGTTTACATAGAAGAGAATGAGACATCAAGTGGCATGGAAAGGCACATACCATCACTGAATCCTTCTTCACACTGTGGTGACAGAGTCACCCA

TTCACAAAAGCAAGACTACCTTTTCCTAAAGGAACACAGAATAGTGTTTACAACTCGACCCAAGTGTTGTAGGTCCCTCCAGAACTTGCAGACTCTCGTA

CTACAGTAAAACAAGATATAAATCCAACTTCAAAGCAGGCTGGGAGAGTACTATCTGATTAAAAAGTCTGGGGGGAAAAAGAACACTGTGAGGGTTTAGC

ATTCATTGTAAGTATAAGTTAATATCTACAGAGAAAAATTAAGTAATTAATGAGAGCTTAGACGATACAATAATAGATTTCAAATGAAGGCTC
Translation
 - UNI30685 - MRSRSSNAEGSAPKQIPRHSKFQDSIQDMKHRTHKKDPSCESEGVLPRPVSEKSHTGKGHHTEDLSRDDLLFLLSILEGELQ ARD

EVIGILRAEKIDLALLEAQYGFVTPKKVLEALQRDAFQAKSAPWQEDIYEKPMNE LDKVVEKHKESHRRILEQLLMVERSHRQTIMEMEEEKRKHKEYM

KKSDEFINLLEQECER RI

For any suggestions or comments, please send an email to unitrap@crg.es