Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075009 (Tet1)
Chromosomal location
Chr 10: 62301845 - 62328011 (-)
Description
tet oncogene 1 Gene [Source:MGI Symbol;Acc:MGI:1098693]
UniGene
Mm.249744 
MGI
MGI:1098693 
Uniprot/SPTREMBL
Q3URK3 
Human Ortholog
not available
Omim not available
UniTrap UNI14203
Vector Insertion
Chr 10: 62327610 - 62327883
Public Clones CMHD-GT_24A3-3 (cmhd) FHCRC-GT-S7-4D1 (fhcrc) (egtc)
Private Clones OST369005 (lexicon) OST43615 (lexicon) OST40538 (lexicon) OST38794 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI350
Vector Insertion
Chr 10: 62303127 - 62327555
Public Clones GC0947 (tigem) AY0320 (sanger) (sanger) AD0370 (sanger) AL0245 (sanger)
CJ0134 (sanger) AL0255 (sanger) AE0732 (sanger) AY0035 (sanger)
AL0709 (sanger) RRJ266 (baygenomics) XB134 (baygenomics) F025D07 (ggtc)
5SE079E01 (ggtc) E018B07 (ggtc) P135F05 (ggtc) 3SE079E01 (ggtc) CMHD-GT_499F7-3 (cmhd)
PST22768-NR (escells) PST25999-NR (escells) PST17766-NR (escells) PST22672-NL (escells)
IST13046A12 (tigm) IST15069G2 (tigm) IST11615D6 (tigm) IST14588C11 (tigm)
Private Clones OST190767 (lexicon) OST38594 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099674
Sequence
GGAGGCTTCCTCTGCAGAAGCAGGCAAGATGGCTACCTCGTGGGCTTCGCCGTGAAGAATGCAGAAGCTAATTAAGACAGACTTTTAGGGGGAAAGGGGG

CATTTCCCTCCATCTTTATTTATGCAAG - UNI14203 - GTTACAAAAGAAAACAAGAGGCCCCAGAGGGAAAAGAAGCCCAAAGTTTTAAAG - U

NI350 - ACAGACTTTAACAACAAACCAGTAAATGGCCCCAAATCAGAGTCCATGGACTGCAGTAGACGTGGTCATGGGGAAGAAGAGCAAAGGTTGGA

TTTGATCACACATCCCCTTGAAAATGTAAGGAAGAATGCAGGCGGCATGACGGGAATTGAGGTGGAGAAGTGGGCGCCAAACAAGAAATCACACTTAGCA

GAGGGTCAAGTCAAAGGAAGCTGTGATGCCAATTTAACTGGGGTGGAAAACCCCCAGCCCTCTGAAGATGACAAGCAGCAAACCAACCCTTCTCCGACAT

TTGCCCAGACCATAAGGAACGGCATGAAAAATGTACACTGTTTACCCACTGACACACACCTTCCGCTCAACAAATTGAATCATGAGGAATTTAGCAAGGC

GTTGGGAAATAATTCCTCTAAATTGCTGACTGATCCCTCAAACTGCAAGGATGCCATGAGTGTCACCACCTCCGGGGGGGAGTGTGATCATCTCAAGGGG

CCAAGGAACACCCTGCTCTTCCAGAAGCCTGGCTTGAACTGCAGGTCTGGTGCAGAACCCACCATCTTTAATAATCACCCTAATACACACAGCGCTGGGA

GTCGACCTCACCCTCCTGAGAAGGTACCCAACAAAGAACCCAAAGATGGCTCTCCGGTTCAGCCAAGTCTTCTATCCCTAATGAAGGACAGGAGATTAAC

GCTGGAACAAGTGGTAGCCATAGAAGCCCTGACTCAGCTCTCAGAAGCGCCCTCAGAGAGCTCCTCCCCATCCAAGCCGGAGAAGGATGAAGAAGCGCAT

CAGAAAACGGCTAGTCTGCTTAACAGTTGCAAGGCTATCCTTCATTCGGTGAGAAAAGACCTCCAAGACCCAAACGTTCAAGGAAAGGGCCTTCACCATG

ACACTGTTGTCTTTAATGGCCAGAACAGAACATTCAAGTCACCTGATAGTTTCGCTACTAACCAAGCACTTATAAAATCACAAGGATATCCAAGTTCACC

TACAGCTGAGAAGAAAGGCGCTGCTGGTGGGAGAGCTCCCTTTGATGGTTTTGAGAATTCACATCCATTGCCCATAGAAAGTCACAATCTTGAAAACTGC

AGTCAGGTACTAAGCTGCGATCAGAATTTGAGTTCCCATGACCCATCATGCCAGGATGCACCCTACAGTCAAATTGAAGAAGATGTCGCAGCACAATTGA

CCCAACTTGCATCCACGATTAATCACATCAACGCCGAGGTCAGGAATGCTGAAAGTACACCAGAAAGCCTTGTTGCAAAGAACACAAAGC
Translation
 - UNI14203 -  - UNI350 - MDCSRRGHGEEEQRLDLITHPLENVRKNAGGMTGIEVEKWAPNKKSHLAEGQVKGSCDANLTGVENPQPSEDDK

QQTNPSPTFAQTIRNGMKNVHCLPTDTHLPLNKLNHEEFSKALGNNSSKLLTDPSNCKDAMSVTTSGGECDHLKGPRNTLLFQKPGLNCRSGAEPTIFNN

HPNTHSAGSRPHPPEKVPNKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQLSEAPSESSSPSKPEKDEEAHQKTASLLNSCKAILHSVRKDLQDPN

VQGKGLHHDTVVFNGQNRTFKSPDSFATNQALIKSQGYPSSPTAEKKGAAGGRAPFDGFENSHPLPIESHNLENCSQVLSCDQNLSSHDPSCQDAPYSQI

EEDVAAQLTQLASTINHINAEVRNAESTPESLVAKNTK

For any suggestions or comments, please send an email to unitrap@crg.es