Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075217 (4833423E24Rik)
Chromosomal location
Chr 2: 85323751 - 85359181 (-)
Description
RIKEN cDNA 4833423E24 gene Gene [Source:MGI Symbol;Acc:MGI:2687041]
RefSeq_dna
NM_001081664 
RefSeq_peptide
NP_001075133.1 
MGI
MGI:2687041 
Uniprot/SWISSPROT
Q0VAX3 
Human Ortholog
not available
Omim not available
UniTrap UNI34632
Vector Insertion
Chr 2: 85330825 - 85333469
Public Clones IST14518H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099923
Sequence
AACAGCCAGCAAGGAGAGAGGTGAAGAAAGAAATGTAGTCTAGTTGTTCTCAGTGCAGAAGATTAACTACAGACCAAAACAGGGCACGCTGGGCAGGTGC

TCTCACTGTCAGTTTCTGAAGAGCCAATTTAGTCAAAGGCTGTGTGGGCACCAGGACTGCTGTGGAATGAAATAGGAGGAAAAGAGTAATTTTAAGGCTC

AATTATAGAACTAGAAAGTTTAGGAGTCAACTTAGATAATCTCAGGGATCCAGGAATAATGAAGTTGGAGGAAAAGCTTGAGCACAATGAGAGCCTTGTT

GGAAAAAGTCGACCGTGTCTCCATGACACGCATCAGGCAAACGGGAAACCGATAGCTAATGGGAATCCGACAGCAAATGGAAAAGTGGAGGTCTATGAAA

AGCAGGAGGCAAATGGCAAGGGCAACAGGCTCGGGAAATGTCTCAACCTGTACACCTGGCAGGAGATCCAGAGACACAGTCAGGAAGCAGACCAGTGGCT

GGTGATTGATCGCAAGGTTTACAATGTGACTGACTGGGCTGGCAAGCATCCAGGTGGACGTCGGGTTCTCAACCACTATGCTGGGCAAGATGCAACG GA

TGCTTTCAGGGCCATGCACCTGGATCTGGGCATGGTGAAGCTGTATCTTAAGCCACTACTCATTGGAGAACTTTCTCCAGAAGAACCAAGCCAAGAGAAA

AACAAAAAC GCACAGTTGGTGGAAGATTTCCGTGAATTGCGCAAGACGTTAGAGGCCATGAACATGTTCAGTGCCAACCTGCGGTTCTTCTTTCTGCAC

CTTGCCCAGATCTTGATCTTGGAAATCTCAGCATGGCTAATACTACACCATTTTGGCAGCAGCTGGCTTGTTACAATACTTATTTCCTTTCTCCTTACAG

TGTCTCAG GCTCAATGTTCATTTTTACAACATGACTTAGGACACCTTTCCATGTTTAAGAAGTCCAAGTGGAACCATCTGATGCACAAATTTGTAATGT

GTCATCTCAAG GGCCTGTCAGCTGATTGGTGGAATTATCGACACTTCCAGCATCATGTAAAACCAAATATCTACCCCAAGGATCCAGACATTGATGTGG

GCCCACTCTTTCTGGTTGGAGATACTCAGCCTATAAAG - UNI34632 - TATGGCAAGAAGAAAATAAAATACATTGACTATGAGAAGCAGCACCTG

TACTTCTACATGG - UNI34632 - TTGCACTCCCCTTCCTCATGCCTGTCTACTTTAATTTGCAATCCATGCAAGTGATGTACCTTCGAAAATACTG

GATG - UNI34632 - GACATTGCATGGGTCAGCAGCTTTTACATTCGTTATTTCATCACATTTGGCCCTTTCTATGGAATTTTCGGAACAGTGTTGC

TCATATATTTGGTCAA GTTTATTGAGAGCCCCTGGATTGCTTACGTTACCCAGATGAGTCACATACCAATGAAAATGAGCAGTGAAGAGAACCACGACT

GGCTCAGCACTCAG GTTGTGGCCACCTGTAATATTGAACAGTCCTTTTTCAATGACTGGTTCACTGGACATTTGAACTTCCAAATTGAACACCA CCTC

TTTCCCACAATGCCACGCCATAATTACCACAAAGTGGCACCTCTGGTGAAGTCACTTTGTGCCAAGCATGGATTGCAGTATATAAATAAGCCCATATTGA

AGGCCTTTGGAGATATTGTCAG GTCCTTGAAGAAGTCTGCTTCCCTCTGGATGAATGCTTACTATGAATGATGCAGAGCCTTGCATTTATTGGTGTCTC

TGAAGAGGGTGATGGCTGTGCATGGGCTTTTCTCTGATTAACTGAGAATTAACTGGCAAAAGCAGCATACATGAGTGTCCCAGGAATGTGAATCCCAAGA

ATATATATTAACCTCTCCCTGAAGGTCTTCTCTGTAACTGAGAGAAAGAAGAAACAGAAAGATGACTTCTGTCAGAATAACAAAGGGAAGACACTCTACT

TTTTCATTAGGGTTAAAATTGGACTTAGTTCCAATAGACCTCAGTGAAATTGTTTCTTGTGGGGGCAGTTAATAATATAACATAGACAGAAGTGAAAGTG

AAAAAAGTAAAGATCTCTGACAGAGCCCATTGGAAATCAGTGTAGTTGTTCTTAGAAGAGAATTGTTTATTTAAGACATCCCTGCTGAATAAATTTTTGC

CTATCTCCTTTCAAATAGGTGAACTTCAAATTGTGACTTTAATTAACATTAAAATACCTTCAAATGCTTGTCTTCACTTTGCACTTTCAGTATTGTAAAT

AAAACGTGTGTGTTATTAGTGT
Translation
MKLEEKLEHNESLVGKSRPCLHDTHQANGKPIANGNPTANGKVEVYEKQEANGKGNRLGKCLNLYTWQEIQRHSQEADQWLVIDRKVYNVTDWAGKHPGG

RRVLNHYAGQDAT DAFRAMHLDLGMVKLYLKPLLIGELSPEEPSQEKNKN AQLVEDFRELRKTLEAMNMFSANLRFFFLHLAQILILEISAWLILHHF

GSSWLVTILISFLLTVSQ AQCSFLQHDLGHLSMFKKSKWNHLMHKFVMCHLK GLSADWWNYRHFQHHVKPNIYPKDPDIDVGPLFLVGDTQPIK - U

NI34632 - YGKKKIKYIDYEKQHLYFYMV - UNI34632 - VALPFLMPVYFNLQSMQVMYLRKYWM - UNI34632 - DIAWVSSFYIRYFIT

FGPFYGIFGTVLLIYLVK KFIESPWIAYVTQMSHIPMKMSSEENHDWLSTQ VVATCNIEQSFFNDWFTGHLNFQIEHH HLFPTMPRHNYHKVAPLVK

SLCAKHGLQYINKPILKAFGDIVR RSLKKSASLWMNAYYE

For any suggestions or comments, please send an email to unitrap@crg.es