Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075225 (5033413D22Rik)
Chromosomal location
Chr 10: 41259039 - 41307247 (-)
Description
RIKEN cDNA 5033413D22 gene Gene [Source:MGI Symbol;Acc:MGI:1923223]
RefSeq_dna
NM_029493 
UniGene
Mm.228517 
MGI
MGI:1923223 
Uniprot/SWISSPROT
Q0VG85 
Uniprot/SPTREMBL
Q9CU97 
Human Ortholog
ENSG00000203798 (C6orf185)
Omim not available
UniTrap UNI22884
Vector Insertion
Chr 10: 41300964 - 41301198
Public Clones not available
Private Clones OST282117 (lexicon) OST177021 (lexicon) OST99615 (lexicon) OST99564 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34252
Vector Insertion
Chr 10: 41300964 - 41306211
Public Clones IST12770G9 (tigm) IST12745B9 (tigm) IST12404G5 (tigm) IST13295G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019955
Sequence
TTGCGTTGTTCCCGTGGAGGGCGTTCCTGGAAGATGGTGGACCATTTCCAGTTATAAGCAGCGTCCCGGACACCCTAGAGTATGATATGCAG - UNI34

252 - ATGTGTCTCTGTGGGCTAAGTGACTGTGACCGCAGAGTGGCCCATGGAGAGCTGGTGGGTGTACAGATGCTAATGGAAGACGTACTTCTGGGCA

GCTGCCACGTGATCAGGAAGGCTTCTACCGAATGGCAAGCTGCACTGGACAATGCACAG - UNI22884 - - UNI34252 - CCAGACTGGTCCAA

ACTGCCAGGACTCTACCCAAATCAATTGGAAAGTCACCCAAAGGCCTCTGCTTTGCTGGAGGGCCAATGTGATGTAGTGATGTCCCTGTCTCTGCTGAAA

TCCTTCCTCATCTTGTGGAAGCGTCTGGAAGTGCTGAAGGAACACTGGGGCCGATTCAAGCTTCGAGGGCAGGACATCAACTCTGCCTTGCTGCATAGAC

AGTTCTCAGAGCTCTACGA - UNI22884 - - UNI34252 - AGCTGAGATTCTCTACCCCAGCATGAAAGCTCTAGCCAGGCAGATGGGCAAAGA

AGATGAATTTGAAGAACTTATGCTAAGAAGCCAATCTATCCTTCCCCCAAAGGGAGCCTCAGAAATTGAAATAAAAACTCAGCAG CTTCAGAAACTTCT

GGAAAGTTTAGAAATTCACATGATCCAAGAAGTATTGAGAAAAGTTAATAGAGAGATGACACTGTTTCTATCAGAAAAGTCCAAGGAGGAGTCTACCCTC

CCAACAG ATCGTTGGAAACACCAAGTCATGAAAGAAAACTTTTCAGTTATGAGACCCCAGATAGTTGAGAGATTTGTACAGAGACTGATGGAGGATTCC

CAAGATGATGGGCCCAAG ATCACTTTCCGGAGGGAGCACCTTGAAGCCTGCATCCTCTCCCTGGGCTGTGACGTGATGGCTCGAGAACGCAGCAACTTT

GAGACCTACTCCATGTGTTATGAGCATATCCTGCAGCATACCAGGCAGAAGCTTAGCCAGAAGGAGCAG GAGGTAGACTTGCTACGAAGAAGTCAAGTT

CCCTCTGAAGACTGTGCTGGACAG GTTGCAGAGCTCAGTCATGACATGATCATGGAAATCACTGCTTTGAGGGCCCAGCTCACAGACCTGGAAGAGGAG

AATCTGAATCTGAAAATCCAGATTAGAAAAGAGGTCCAGGAAGAGTACAGAGAATTAGTGCAGGCGTTGTTTCTGACCTGCTTACGCATAAAG GAGAAG

TTGGATGAGAATCAGTTTAATTTGATCCAGAAAGTGTGTGAGCTCATCGGGGAAGTGAGAGCTGAAGGGATTGCCAACGTGAAACAGCTAAAGAAAACCT

GGGGCTCTGCCAGACCTGATGAAGAAACAAAAGAGAACACAGCCAAG GAATCTATTCTCAGTAAAAAGGAGTGCTTGAGAATCAAGCTAATGGCAGAGC

AAGAAGCGGCTTTACTCCATCAACAGCTCCTGGCTGCAAGGCAAGCCCTGACCAAAGCTCAGACTGACAACAGGAAGCTGTGGCGGCAGAATGATACTCA

G GCTCAACTGCTGAGGGAGTTGGAACACAGAGTGACTCAAGACTCTGTCACTCGGCAGCAGCTGGATATCATAAAAACATCTGGCATGGAGAAGCTCCT

AAAAGATGTGGAGCAAAAAGAGCAAAAACTACAGCTCCTGACAGAAGAGGCTGAGCGGGCTTCGAAACGAGGCCAGCTGCAGCAAAAGAAGATGGACAGA

GACCTGAAGCAGGTGAGGGCTGCTGACCCTGACCTTAAAGGCCTGAGGAGCCAGCTCTCCATGGAACAGCTGTTCCCAGGACTCTCTGTTCCCCTCACAG

CATTCTCTCTCCTCTGTCAGTTCTAG
Translation
 - UNI34252 -  - UNI22884 - - UNI34252 -  - UNI22884 - - UNI34252 -      MIMEITALRAQLTDLEEENLNLKIQIR

KEVQEEYRELVQALFLTCLRIK EKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGSARPDEETKENTAK ESILSKKECLRIKLMAEQEAALLHQ

QLLAARQALTKAQTDNRKLWRQNDTQ AQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQVRA

ADPDLKGLRSQLSMEQLFPGLSVPLTAFSLLCQF
Transcript ENSMUST00000095227
Sequence
CAGGAGGTAGACTTGCTACGAAGAAGTCAAGTTCCCTCTGAAGACTGTGCTGGACAG GTTGCAGAGCTCAGTCATGACATGATCATGGAAATCACTGCT

TTGAGGGCCCAGCTCACAGACCTGGAAGAGGAGAATCTGAATCTGAAAATCCAGATTAGAAAAGAGGTCCAGGAAGAGTACAGAGAATTAGTGCAGGCGT

TGTTTCTGACCTGCTTACGCATAAAG GAGAAGTTGGATGAGAATCAGTTTAATTTGATCCAGAAAGTGTGTGAGCTCATCGGGGAAGTGAGAGCTGAAG

GGATTGCCAACGTGAAACAGCTAAAGAAAACCTGGGGCTCTGCCAGACCTGATGAAGAAACAAAAGAGAACACAGCCAAG GAATCTATTCTCAGTAAAA

AGGAGTGCTTGAGAATCAAGCTAATGGCAGAGCAAGAAGCGGCTTTACTCCATCAACAGCTCCTGGCTGCAAGGCAAGCCCTGACCAAAGCTCAGACTGA

CAACAGGAAGCTGTGGCGGCAGAATGATACTCAG GCTCAACTGCTGAGGGAGTTGGAACACAGAGTGACTCAAGACTCTGTCACTCGGCAGCAGCTGGA

TATCATAAAAACATCTGGCATGGAGAAGCTCCTAAAAGATGTGGAGCAAAAAGAGCAAAAACTACAGCTCCTGACAGAAGAGGCTGAGCGGGCTTCGAAA

CGAGGCCAGCTGCAGCAAAAGAAGATGGACAGAGACCTGAAGCAGGTGAGGGCTGCTGACCCTGACCTTAAAGGCCTGAGGAGCCAGCTCTCCATGGAAC

AGCTGTTCCCAGGACTCTCTGTTCCCCTCACAGCATTCTCTCTCCTCTGTCAGTTCTAGGCACACCTGGAAATGGTTCTCTGTATACCACCCTGGGGCCA

GTGCTTAAGCAAGACTGCTCCAGGCTCTGAGTCCTAGTGTCCTGAGGATAATTTGTTTTCATACTGCCTTAACCTTTGAACTGGGGTCTTCCAGAGAACT

GTGAGCTATAATCTGGAAGAGCAGCAAGCACATAAAAGCTATAATAAGAGGTTTTTATTCCAGTGTGTCTAGAATTACAAAGTCAGAGATGAAAAGCAAA

AGTGGATTTCAGACATAATTTTTATAACTATATCCCCTGGGGAAATAGAAAGGGGTTATTATAATGCATGTATGGATTAATTCAACCTCCATAAGCAGGC

TACAGAAGGTAATTCAATAAAACCCGACACAGAAGGTGCTTTACACAGATCCATGGGTGAAGAAAGCCCTTAATTCATTCCCTAGAGATAATAACAGACA

GAAAAGCAATTTGAAAATTAAATAGAACTATTATTGGTCAAGGGTTTCAAGGGCTCTAGAAGAAGTTCTGTAAAGAGAATAAATTGAATTGAGGGAGTGC

TGAATAAAATACTTTCAAGGAATGGAGAGAGAGGTTGAGCTGTTGCAGAGTGAAAGGAAATTAGAATTTCACATTTATGAACTGGGCATGGTGACTCATG

TCTGTAATCCCAGCACCAGGGACACTGAGGCATGAGGCTTGCCGTGAGTGGAAGTCAATCAAAGCTACACAGAGAAAACACCTACAGAAAATGTACCTTT

CCAGCCATGCTGGGACTCACTGAGTCTTACAGGGGAGCTGTGTGATACCTATCTTAATTGGCATTTTTATCAGAAGGCCACCTGCTATATAATAATTTCA

GAAGGTGTAGGATTCCATGGAGCCTACTTCAGACAGGCTTTTGGAAATAACTTTTAGGTAACTCAGGAGGTCACATCATCCCAGGAAGCTACTTTTTCTC

TTAAAACTAAAAGAAAAATGATCCAGATATTATCCTTATAATGACTATTAATTTGTTCCACCAGCTGCTGACTATGAAGGAGTGATATAGTGCCCACATC

CTTCAAATGTGCTCATATAGAACTAGTTACTTGTGTTAAATTTTCCTATTGCTGTGACAAAATACCTGACAAGAGCGACTTAAGGGAGGAAGGGTTTCTT

TCAGCTCACAGTTTGAGGGGATTTGGCTCACAGGTTGAGGAAATACAGTCCATTGGCTCACAGTTTTAGGGGATACAGTCCATTGGCTCACAGTTTGAGG

GGATACAGTCCGTTGGCTCACAGTTTATGGGGATAAAGTCCATTGGCTCACAGTTTGGGGGATACAGTTTGTTGGCTTACAGTTTGGGGGATACAGTTCA

TCAGGGTAGAGAAGGCAAATATGCAGAAGTGTAAGGTTGCTGGTAATATCACATCTCCCATCAGGAAGCAGAGCGGGGATGAGAAATAAAGCTAGACTAT

AAAACTTGACTCTGTGACCTACTTCCTCCATTTAGGCTCTACTGTCTTAAGTTTCCACAGCCTTGTAAAACACAAGCTGGGAATTAAGTGTTTCAACACA

TGAGCTATGTAAGACATTTAACATTCAAACTATAATCCTACATTAATTATTATTTTAGTTATTATTGCTTAATTGTTATTTAGTTAATGGCAGTAATTCT

GATGCAATTAAAATAAGTATCTTGAGATTTTTCTCAATC
Translation
 MIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIK EKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGSARPDEETKENT

AK ESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQNDTQ AQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQL

LTEEAERASKRGQLQQKKMDRDLKQVRAADPDLKGLRSQLSMEQLFPGLSVPLTAFSLLCQF
Transcript ENSMUST00000099932
Sequence
TTGCGTTGTTCCCGTGGAGGGCGTTCCTGGAAGATGGTGGACCATTTCCAGTTATAAGCAGCGTCCCGGACACCCTAGAGTATGATATGCAG - UNI34

252 - ATGTGTCTCTGTGGGCTAAGTGACTGTGACCGCAGAGTGGCCCATGGAGAGCTGGTGGGTGTACAGATGCTAATGGAAGACGTACTTCTGGGCA

GCTGCCACGTGATCAGGAAGGCTTCTACCGAATGGCAAGCTGCACTGGACAATGCACAG - UNI22884 - - UNI34252 - CCAGACTGGTCCAA

ACTGCCAGGACTCTACCCAAATCAATTGGAAAGTCACCCAAAGGCCTCTGCTTTGCTGGAGGGCCAATGTGATGTAGTGATGTCCCTGTCTCTGCTGAAA

TCCTTCCTCATCTTGTGGAAGCGTCTGGAAGTGCTGAAGGAACACTGGGGCCGATTCAAGCTTCGAGGGCAGGACATCAACTCTGCCTTGCTGCATAGAC

AGTTCTCAGAGCTCTACGA - UNI22884 - - UNI34252 - AGCTGAGATTCTCTACCCCAGCATGAAAGCTCTAGCCAGGCAGATGGGCAAAGA

AGATGAATTTGAAGAACTTATGCTAAGAAGCCAATCTATCCTTCCCCCAAAGGGAGCCTCAGAAATTGAAATAAAAACTCAGCAG CTTCAGAAACTTCT

GGAAAGTTTAGAAATTCACATGATCCAAGAAGTATTGAGAAAAGTTAATAGAGAGATGACACTGTTTCTATCAGAAAAGTCCAAGGAGGAGTCTACCCTC

CCAACAG ATCGTTGGAAACACCAAGTCATGAAAGAAAACTTTTCAGTTATGAGACCCCAGATAGTTGAGAGATTTGTACAGAGACTGATGGAGGATTCC

CAAGATGATGGGCCCAAG ATCACTTTCCGGAGGGAGCACCTTGAAGCCTGCATCCTCTCCCTGGGCTGTGACGTGATGGCTCGAGAACGCAGCAACTTT

GAGACCTACTCCATGTGTTATGAGCATATCCTGCAGCATACCAGGCAGAAGCTTAGCCAGAAGGAGCAG GAGGTAGACTTGCTACGAAGAAGTCAAGTT

CCCTCTGAAGACTGTGCTGGACAG GTTGCAGAGCTCAGTCATGACATGATCATGGAAATCACTGCTTTGAGGGCCCAGCTCACAGACCTGGAAGAGGAG

AATCTGAATCTGAAAATCCAGATTAGAAAAGAGGTCCAGGAAGAGTACAGAGAATTAGTGCAGGCGTTGTTTCTGACCTGCTTACGCATAAAG GAGAAG

TTGGATGAGAATCAGTTTAATTTGATCCAGAAAGTGTGTGAGCTCATCGGGGAAGTGAGAGCTGAAGGGATTGCCAACGTGAAACAGCTAAAGAAAACCT

GGGGCTCTGCCAGACCTGATGAAGAAACAAAAGAGAACACAGCCAAG GAGCAGCTGTGTGCCTTGGAGCAGGACCACAGCAGCACCCTGGCTGCTCTAC

TGTGCAAAGCGCGGAGCCTGGGCCGCTGGCGGCTGGCTGTGCAGCAGGCACACCTCAGAGGGCAGCTGAGCAGGGCAGAGATG GAATCTATTCTCAGTA

AAAAGGAGTGCTTGAGAATCAAGCTAATGGCAGAGCAAGAAGCGGCTTTACTCCATCAACAGCTCCTGGCTGCAAGGCAAGCCCTGACCAAAGCTCAGAC

TGACAACAGGAAGCTGTGGCGGCAGAATGATACTCAG GCTCAACTGCTGAGGGAGTTGGAACACAGAGTGACTCAAGACTCTGTCACTCGGCAGCAGCT

GGATATCATAAAAACATCTGGCATGGAGAAGCTCCTAAAAGATGTGGAGCAAAAAGAGCAAAAACTACAGCTCCTGACAGAAGAGGCTGAGCGGGCTTCG

AAACGAGGCCAGCTGCAGCAAAAGAAGATGGACAGAGACCTGAAGCAG ATGAGAAACCGGCTTGCTCAGGAGCGCAGCGTGAAGCTGGATGCCTTCCAG

CGAGTGCAGGAGCTGCAGAGTCAGCTTTATGACATCCAGTGGCCCTCTGTCCAGATGGGCTCCCCAGTCG GGCTCAGATCCCAGACCCACTGCTCCCTA

AGCTCTGCTTCAACATTATCCAGACACCCTCACCACCATTTTTCAAAGACTCATTTTGTGGGCAGTAAAATGACAAGAAGGATTCAAAGACCAAAGACT 

GTGCCAGTCAAACACAACAGAAGGATTGAGGATGGTTCTCTACCCAGTGTGAAAGAAAATGTTCAACTTACAACTTTTCAAGCCCAAACAGCTCCATCTG

GGATTTCATTTAGACCTGAAAG CTTTTCTTCCTAGTGTGTGGCAGTTGGTCTGAGATGAACTCATCTTGAGTGTCCCTACCACATGAAGCCAGC
Translation
MQ - UNI34252 - MCLCGLSDCDRRVAHGELVGVQMLMEDVLLGSCHVIRKASTEWQAALDNAQ - UNI22884 - - UNI34252 - PDWSKL

PGLYPNQLESHPKASALLEGQCDVVMSLSLLKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYE - UNI22884 - - UNI34252 - E

AEILYPSMKALARQMGKEDEFEELMLRSQSILPPKGASEIEIKTQQ LQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTD DRWKHQVMKEN

FSVMRPQIVERFVQRLMEDSQDDGPK ITFRREHLEACILSLGCDVMARERSNFETYSMCYEHILQHTRQKLSQKEQ EVDLLRRSQVPSEDCAGQ VAE

LSHDMIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIK EKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGSARPDEETK

ENTAK EQLCALEQDHSSTLAALLCKARSLGRWRLAVQQAHLRGQLSRAEM ESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQN

DTQ AQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQ MRNRLAQERSVKLDAFQRVQELQSQ

LYDIQWPSVQMGSPVG GLRSQTHCSLSSASTLSRHPHHHFSKTHFVGSKMTRRIQRPKT VPVKHNRRIEDGSLPSVKENVQLTTFQAQTAPSGISFRP

ES SFSS

For any suggestions or comments, please send an email to unitrap@crg.es