Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075259 (AC126430.3)
Chromosomal location
Chr 10: 31409148 - 31671294 (-)
Description
Na+/K+ transporting ATPase interacting 2 short isoform  [Source:RefSeq peptide;Acc:NP_001020457]
Human Ortholog
not available
Omim not available
UniTrap UNI38338
Vector Insertion
Chr 10: 31466307 - 31671126
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105513
Sequence
TCAAAA - UNI38338 - GAAACAGACCTTATCCTGACATTTAATATTTCAATGCACCGATCTTGGTGGATGGAGAATGGACCAGGATGTATGGTGAC

GTCTGTGACACCTGCCCCAGACTGGGCTCCAGAAGACCATCGCTACATCACTGTCTCAGGGTGTTTTCTGGACTACCAATACATAGAAGTGGCTCATAGT

TCCCTCCAGATTGTCCTCGCAGTAAGTGTTGACAACAAACCACTCCTTCTAGTGTTTCTGGAATTGTTTTTTCTGGGCAAACACTGTGTGCAAAAGGACT

GTATGTTGATGTGGAATGTGTGTGGGCATTTTTTTTAG
Translation
SK - UNI38338 - ETDLILTFNISMHRSWWMENGPGCMVTSVTPAPDWAPEDHRYITVSGCFLDYQYIEVAHSSLQIVLAVSVDNKPLLLVFLELFF

LGKHCVQKDCMLMWNVCGHFF
Transcript ENSMUST00000099978
Sequence
GAAACAGACCTTATCCTGACATTTAATATTTCAATGCACCGATCTTGGTGGATGGAGAATGGACCAGGATGTATGGTGACGTCTGTGACACCTGCCCCAG

ACTGGGCTCCAGAAGACCATCGCTACATCACTGTCTCAGGGTGTTTTCTGGACTACCAATACATAGAAGTGGCTCATAGTTCCCTCCAGATTGTCCTCGC

A - UNI38338 - CTGGCGGGCTTCATCTATGCCTGTTATGTTGTGAGATGTATAACTGAAGAAGAGGACAGCT - UNI38338 - TTGACTTCAT

AGGTGGCTTTGATTCTTATGGATACCAAGGGCCTCAGAAGACATCTCACTTACAACTTCAACCAATGTACAT GTCAAAATAACACAGATGGCTCTGTCT

GTCAGCCCATGGACTCCTCAAATGATTTGTGCGGTGGCCTCTTGCCTTTTATGAAGCTCAAGAAGCAAATGGATTTAAATACACATACATGTTATCAGAC

CAAACAGGAAGTTTCTACATAGACACATGAGTGAACACACACACACACCCACCACTGCCATTATCATGCACACATCAACTACACTGGACCTCCTCTTTCT

GACTGAAACTGATAAATATGCAGGATACCCCCATCCTAGATTTCCTTAATGCAGGTTCCCTTCTTCCAGACCTTTGAAGGTGGGAAAGGAGCTGTATGTG

TGTCTTCTGCAGATCCCTACTTACCCATCTGCAGCCCAGCCAGTTGGCTCTGTGAGGTGCCAAGTTAACCCAGGCACACAAGTTTGGAACCCTGTTCTCT

GCACTCCATACAATACATCTTGATTACACCACAGCTACTTTACTTGCAAAAACTGGTCAGACAGAACATGCCATGATGACCTTGTACCAAATGCAAAATG

GCAGGTCGTTTGCCCTAAAGGCTATACTGTACATACTTGCCTTAAACCACCTGCATTGTGTGCCCGAGACTCTCAGTGCAAATGTCCCCCAGTCACATCC

TTTAGGCGAACACACTGCTATTAATTCCGGACTATTGAATCAAGGAATAAGACTGAACCACTCAGCAGCTCCAGTGTGTCTGTAAGAAATTGATGTTTTA

CTACTGAGCCTCTTCAGTGGCCACAAAGAGACAAAGAACCAACAACAACAGTAACTGTCATCTTCATGTCTCTTAAACATGGTCTTCTGATGGTGGAACA

AAGTAAAATGTATTATTCTACTAAACTCATTAATCTACTAAAAGCAGAAATGGCTTGACTGGTTGGTTTTCTTTCTGGCACTTTAAGTGCTTTTCTAAGT

CTCTGCGAATCGTTTTTCCTAACAGAGGAAACAGTTGTGGATTTCTATGACAGAGACCAACTATGTATTAGCTATGTTTACTCTTTTATATCTAATTCAA

ATCCAAGATCCAATGTAGGTGAACTTTCTTTTCTAACTTCAGCATACAAGATTATTTTTGGGGCGGGTGGGTGGGGTGCAATAGTTAACTTAGTGGAATC

TTTGAGATCTCTTTGTGATATTTGGGGGATCTGTTGTGTGTTATACTGTATTCCAATTCTGTATTAGTGTGGCAGAAGAAAAAAAACGTGCTGTTGACGT

AGTTGGCAATGAGATACCTTTGGAGACAATAGTAGATCAATGTGTTTATGGGATATTCTGAACTACTAGGCAATTTAGTTTTATATTTTCAAGCACTCTT

TGGTTTTCATTAGTGGAAGACATAATTAGCTCAAGCTTATCAGTAACACGAATGAGTCATGCTTTTCTTGAATCTACTTGAGACACTAAATTCAAGTTTT

CTTTAGCACATCACCTTCGTGTGCAGTGAAATTCAGACTGAGAAGTTAAACATTGGCATGGAACAACTCCTTTTCTTTTGGTATTTACTTTTCTTTTAGT

TTCAGTTTCTGGGTTAACCCTTTTTGCATTCAGATCTCCATTAAGACAGGCCAGTTGCTGTCTTTGCAAAAATGTTTGCAACACATGCCCATTTGAACCC

ATTTAAACTCAATGAAGGCACTAAAAATGGCCATTGAAACATAAACTTCATGCACAAAAAGGTTTTAACACTCACACTTGAGTTTTCCCAGTGGCTTGTA

TATGTCAGTGCATACCTATATGTGTGAAATGGACAGTTGCAAACACATCAGTGAAACCTCATATGGTGTTTTTATAGTGATATGCATGTTTAATGTTTGA

GGAACTAGTTGCCAATGTACTGTCCTTTTATTCCTAAAATATAAATACTATACATGCCAGAAGCTATTCTAATGTGACTTTTGACATGAGGTTTCACTGC

ATTGCTGCTGGGATGGGATTCCACCTTGTAGTACATGTGTAGGGAGGGAGTAATATAAGCTATCATGTTTCCTTTTAAGTTGCAGCCAACTCTCCACCAA

GTCAGTATATCATCACCACCAAAGTTTTCAGAAACAGTTGTTGACTACTCTTGAGTAGTCAGTGGGCGGGCCTTTTTAGGAGCAGTAAGCAAAGTAGTGT

GATTCTAGCTGGGAAACATCAAAGCTGTCAGCTGTATCCTCCTCAAAACCTGGTGAAGAATGCTATTTTTCTAGGCTGAACTTTTGTTATAAACCTAATA

TTCTGAAAGCAAGAGTTAACTATCCTGATCAGTCTTTTTTTCTCCTCTTGGATTTGTTAATTCTGAATGTATTTTTAACAGAGTGATTTTTTTGACTTTA

CTAGTGTAATTTGCATTTT
Translation
MHRSWWMENGPGCMVTSVTPAPDWAPEDHRYITVSGCFLDYQYIEVAHSSLQIVLA - UNI38338 - LAGFIYACYVVRCITEEEDSF - UNI383

38 - FDFIGGFDSYGYQGPQKTSHLQLQPMYM MSK

For any suggestions or comments, please send an email to unitrap@crg.es