Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075370 (Igll1)
Chromosomal location
Chr 16: 16860908 - 16864078 (-)
Description
immunoglobulin lambda-like polypeptide 1 Gene [Source:MGI Symbol;Acc:MGI:96529]
MGI
MGI:96529 
Uniprot/SWISSPROT
P20764 
Human Ortholog
ENSG00000206066 (IGLL3)
Omim 601495 - AGAMMAGLOBULINEMIA, NON-BRUTON TYPE, AUTOSOMAL RECESSIVE  
UniTrap UNI13377
Vector Insertion
Chr 16: 16862638 - 16863788
Public Clones CMHD-GT_465F11-3 (cmhd) CMHD-GT_314A02-3 (cmhd) CMHD-GT_465G11-3 (cmhd) CMHD-GT_477E6-3 (cmhd)
CMHD-GT_309B12-3 (cmhd) FHCRC-GT-S5-2A1 (fhcrc) FHCRC-GT-S13-11D1 (fhcrc) PSTVUpb18a8 (vanderbilt)
Private Clones OST448302 (lexicon) OST401577 (lexicon) OST391765 (lexicon) OST327224 (lexicon)
OST323922 (lexicon) OST306723 (lexicon) OST291823 (lexicon) OST279919 (lexicon)
OST246026 (lexicon) OST236611 (lexicon) OST219124 (lexicon) OST217784 (lexicon)
OST206333 (lexicon) OST205369 (lexicon) OST177897 (lexicon) OST150447 (lexicon)
OST63685 (lexicon) OST61390 (lexicon) OST61280 (lexicon) OST57975 (lexicon)
OST38500 (lexicon) OST36121 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12791
Vector Insertion
Chr 16: 16861228 - 16862521
Public Clones CMHD-GT_377B11-3 (cmhd) CMHD-GT_106E1-3 (cmhd) CMHD-GT_397A1-3 (cmhd) CMHD-GT_370A5-3 (cmhd)
Private Clones OST201074 (lexicon) OST190727 (lexicon) OST90604 (lexicon) OST23049 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100136
Sequence
CTGGAATAGCTTTTGGCCACCAGAGGAGGAACAATCCTTTTGCCGGGAGATCTACACTGCAAGTGAGGCTAGAGTTGACTTTGGACTTGAGGGTCAATGA

AGCTCAGAGTAGGACAGACTCTGGGCACTATCCCCAGGCAGTGTGAAGTTCTCCTCCTGCTGCTGCTGTTGGGTCTAGTGGATGGTGTCCACCACATACT

TTCCCCAAGCTCAGCAGAAAGGAGCAGAGCTGTGGGCCCTGGAGCTTCAGTGGGAAGCAACAGGCCTAGCCTATGGGCCCTTCCCGGCAG - UNI1337

7 - GCTCCTGTTCCAGATCATCCCACGGGGAGCAGGTCCCAGGTGCTCGCCCCATAGGCTTCCATCTAAGCCCCAGTTTTGGTATGTCTTTGGTGGTGG

GACCCAGCTCACAATCCTAG - UNI12791 - GTCAGCCCAAGTCTGACCCCTTGGTCACTCTGTTCCTGCCTTCCTTAAAGAATCTTCAGGCCAACA

AGGCCACACTAGTGTGTTTGGTGAGCGAATTCTACCCAGGTACTTTGGTGGTGGACTGGAAGGTAGATGGGGTCCCTGTCACTCAGGGTGTAGAGACAAC

CCAACCCTCCAAACAGACCAACAACAAATACATGGTCAGCAGCTACCTGACACTGATATCTGACCAGTGGATGCCTCACAGTAGATACAGCTGCCGGGTC

ACTCATGAAGGAAACACTGTGGAGAAGAGTGTGTCACCTGCTGAGTGTTCTTAG
Translation
MKLRVGQTLGTIPRQCEVLLLLLLLGLVDGVHHILSPSSAERSRAVGPGASVGSNRPSLWALPGR - UNI13377 - RLLFQIIPRGAGPRCSPHRLP

SKPQFWYVFGGGTQLTILG - UNI12791 - GQPKSDPLVTLFLPSLKNLQANKATLVCLVSEFYPGTLVVDWKVDGVPVTQGVETTQPSKQTNNKYM

VSSYLTLISDQWMPHSRYSCRVTHEGNTVEKSVSPAECS

For any suggestions or comments, please send an email to unitrap@crg.es