Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075376 (Rc3h2)
Chromosomal location
Chr 2: 37225589 - 37278423 (-)
Description
ring finger and CCCH-type zinc finger domains 2 Gene [Source:MGI (curated);Acc:Rc3h2-001]
RefSeq_dna
NM_001100591 
RefSeq_peptide
NP_001094061.1 
UniGene
Mm.288785 Mm.409991 
MGI
MGI:2442789 
Uniprot/SWISSPROT
P0C090 
Uniprot/SPTREMBL
A2AVP4 Q148V4 Q148V5 
Human Ortholog
ENSG00000056586 (RC3H2)
Omim not available
UniTrap UNI25184
Vector Insertion
Chr 2: 37274988 - 37278286
Public Clones (ggtc)
Private Clones OST192570 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17386
Vector Insertion
Chr 2: 37270335 - 37274951
Public Clones not available
Private Clones OST443660 (lexicon) OST353034 (lexicon) OST275641 (lexicon) OST196087 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1827
Vector Insertion
Chr 2: 37253877 - 37255106
Public Clones BC0232 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8945
Vector Insertion
Chr 2: 37245411 - 37253763
Public Clones RRE187 (baygenomics) RRE314 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112934
Sequence
GTAGCTCCCGATGGAGTTTGAGGCCCTGAAACCGCCGCCGAGCTCTGCCCCGGCGAGACGAGGCGCCTCCGTCGCCGAGCCGCGCCGTCGCGGGGCCCCC

GGGAGCGGCCCTTAGCGACCCCGCCCGGGCCCCTCAG - UNI25184 - TACCGGGGATTGAATTTAAAGCTTCACAAACATTAG - UNI17386 -

 CTTAAAAAACACTACACATCAAAATAATGATCTGCTAGACTGCTAACCCGAGCATCAGCTTCCACAATGCCTGTGCAGGCAGCTCAATGGACAGAGTTT

CTGTCCTGTCCAATCTGCTATAATGAATTTGATGAGAATGTGCACAAACCCATCAGTTTAGGTTGTTCACACACAGTTTGCAAGACCTGCTTGAATAAAC

TTCACCGAAAAGCGTGTCCTTTTGACCAGACTGCCATAAACACAGACATTGATGTGCTCCCTGTCAACTTTGCACTTCTTCAGTTAGTTGGAGCCCAG G

TACCAGATCATCAGTCAATAAAGTTAAGTAATCTAGGTGAGAATAAACACTATGAAGTGGCAAAAAAATGCGTAGAGGACTTGGCACTCTACTTAAAACC

ACTAAGTGGAGGTAAAG GTGTAGCTAGTTTGAACCAGAGTGCCCTGAGCCGTCCAATGCAAAGGAAACTAGTTACACTTGTAAACTGTCAACTGGTGGA

AGAAGAAGGTCGTGTCAGAGCTATGCGAGCGGCCCGTTCACTAGGAGAAAGAACTGTGACAGAACTGATACTGCAGCACCAGAACCCTCAGCAGCTGTCT

GCCAACCTGTGGGCTGCTGTCAGGGCTCGAGGATGCCAGTTTCTAGGGCCAG CTATGCAAGAAGAAGCCTTGAAGTTGGTATTGCTGGCATTAGAAGAT

GGTTCTGCTCTCTCTAGGAAAGTTCTAGTACTTTTTGTTGTGCAAAGACTAGAACCAAGATTTCCTCAGGCATCAAAAACAAGTATTGGCCATGTTGTGC

AGCTATTGTACCGAGCTTCTTGTTTTAAG GTTACTAAAAGGGATGAAGACTCTTCCCTGATGCAGCTAAAGGAGGAATTTCGGAGTTACGAGGCACTAC

GCAGAGAACATGATGCCCAGATTGTTCATATTGCCATGGAAGCAGGACTCCGTATTTCACCTGAGCAGTGGTCTTCACTGCTGTATGGGGACTTGGCTCA

TAAATCACACATGCAGTCTATCATTGATAAG CTACAGTCTCCAGAATCATTTGCAAAGAGTGTCCAGGAATTGACAATTGTTTTGCAGCGAACTGGTGA

CCCTGCTAATTTAAATAGGCTGAGACCTCATTTAGAGCTTCTTGCAAACATAGACCCTAATCCAG ATGCTGTTTCACCAACTTGGGAGCAACTGGAAAA

TGCAATGGTAGCTGTTAAAACAGTTGTTCATGGTCTTGTGGACTTCATACAAAATTATAGTAGAAAAGGCCATGAGACACCTCAG - UNI1827 - CC

ACAGCCAAACAGCAAGTATAAAACTAGTATGTGCCGAGATTTACGACAACAAGGGGGTTGTCCACGAGGAACAAATTGTACATTTGCCCATTCTCAGGAA

GAGCTTGAAAA - UNI8945 - GTACCGATTAAGGAACAAAAAGATGAGCGCGACTGTAAGAACATTTCCTCTTCTGAATAAAGTTGGTGTAAACAGC

ACTGTCACAACCACAGCCGGAAATGTCATTTCTGTCATAGGAAGTACTGAAACAACTGGGAAAATTGTTGCAAGTACAAATGGAATTTCAAATACAGAAA

GCAGTGTTTCTCAGCTAATCCCACGAGGCACTGACAGTGCAGTAAGGACTTTGGAGACTGTGAAGAAAGTCGGGAAGGTTGGCACTAATGCTCAGAATGC

TGGGCCCTCTGCAGAGTCCGTGTCTGAAAA TAAAATTGGTTCTCCACCCAAGACTCCTGTAAGTAATGCAGCAGCTACCTCCGCTGGGCCCTCTAATTT

TGGAACAGAGCTGAATTCCCTGCCTCCCAAATCCAGCCCATTTCTAACTAGAGTTCCAGTATATCCTCAGCATTCTGAAAGCATTCAGTATTTTCAAGAT

CCAAGGACTCAGATACCTTTTGAAGTCCCACAATACCCACAAACAG GATACTACCCACCACCTCCAACGGTACCAGCTGGTGTGACTCCCTGTGTTCCT

CGCTTTGTGAGGTCCAGTAATGTTCCAGAGTCCTCCCTCCCACCTGCTTCCATGCCATATGCTGATCATTACAGTACATTCTCCCCTCGAGATCGAATGA

ATTCTTCTCCTTACCAACCTCCTCCTCCGCAGCAGTATGGACCAGTTCCTCCAGTACCCTCTGGAATGTATGCTCCGGTGTATGACAGCAGGCGCATCTG

GCGCCCAGCTATGTACCAACGAGATGACATTATTAGAAGCAATTCTTTACCTCCAATGGATGTGATGCACTCATCTGTCTATCAGACATCTTTACGGGAA

AGATACAACTCATTAGATGGATATTATTCAGTGGCTTGTCAGCCACCGAATGACCCAAGGACAACTGTGCCTTTACCAAGG GAACCTTGTGGTCATTTG

AAGACCAGTTGTGAGGAACAGTTAAGAAGAAAGCCAGATCAGTGGACACAGTATCATACCCAGAAAACACCTGTCTCTTCAACTCTTCCTGTGGCCACAC

AGTCACCAACACCACCTTCTCCTCTATTCAGTGTAGACTTCCGATCGGAT TTCTCTGAGAGTGTGAGTGGCGCAAAATTTGAGGAAGACCATCTTTCCC

ATTATTCTCCCTGGTCTTGTGGTACCATAGGCTCTTGTATAAATGCCATTGATTCGGAGCCCAAAGACGTAATTGCTAATTCAAATGCTGTATTGATG G

ACCTGGACAGTGGGGATGTAAAGAGAAGAGTGCATTTATTTGAAGCTCAGAGAAGGACAAAAGAAGAAGACCCAATTATTCCCTTTAGTGACGGACCCAT

TATCTCAAAATGGGGTGCAATTTCCCGATCCTCCCGAACAGGTTACCATACAACAGATCCCGTCCAGGCAACTGCTTCCCAAGGAAGTGCAACTAAGCCC

ATCAGCGTATCAG ATTATGTCCCTTACGTGAATGCTGTCGATTCAAGGTGGAGTTCATATGGCAACGATGCTACATCATCAGCACACTATATTGAACG 

GGACAGATTCATTGTTACTGATTTATCTGGTCATAGAAAGCATTCTAGTACCGGAGACCTTTTGAGCATTGAACTTCAGCAG GCCAAGAGTAACTCATT

ACTTCTTCAGAGGGAAGCTAATGCTCTGGCCATGCAACAAAAGTGGAATTCCCTGGATGAAGGCCGTCACCTTACTTTAAATCTTCTAAGCAAGGAAATT

GAACTAAGAAATGGAGAG AATGACTACACAGAAGACACTGTAGATACAAAGCCTGATAGGGATATTGAGTTAGAGCTTTCAGCCCTTGATACTGATGAA

CCTGATGGCCAGAGTGAACAAATTGAA GAAATTTTGGACATACAACTTGGTATCAGTTCTCAAAATGACCAGTTGCTCAATGGAACAGCAGTGGAAAAT

GGTCATCCAGCCCAGCAGCACCAGAAGGACCCAGGAAAGCCGAAGAGACAGAGTTTAG GGAGGAGCAAAAACCAATTCTGCCGGTAACATCTTGCTTTA

GCCAGCCACGTCCAATGTCTATTAGCAGTGCAAGCTGCCTCCCCATCACCACATCTGTCAGTGTTGGCAACCTCATTCTGAAAACTCACGTTATGTCTGA

AGATAAAAACGACTTTTTAAAACCTATTGCAAATGGGAAGATGGTTAACAGCTGAAAGGAGGCTCAGCTTTCAAATCTGTGACCACACCATGGAAGCATT

TACACTAGCTTTTTATATATATAATATATATTATATAATGTATATTTTTTTTAAAAAAAAAGATATTACTGGGGGCATCCATTTCCTGTGGACTCTTTGA

TACTTCAAGCCCTCTTGCATTAGCATTATGAAAAAAAAGAAAATTTACTTTACTAGGGTAATGTTCACTTTCCAGAAATTATTGGAATTTGGACAACATT

TAACTTAAGCTTCAAGCAGCTTTTTATGAGTTTGTAGCAATCCGGTGCAGTAACTGAGCCATTTCCTATTTTAAATGGCTTCTACAGTAAATTAACAACT

CAGTTATTAAACTAGCAGGATCCTACAATGATACATCTAGTGAAAGTAGAGTTAATTAACTTATTTCTATTTTATGTTTCACTGAGAGAAATTTCCATCT

CATTCCAGCTGCTTTATTTATCTTTTTCATTGGACTTTGCATGGATTTTTCTTTCTTTCTTTTTTTGTTTTGTTTTGTTTTGTTTTTCCTTTTCTTTTCT

GTCTTTTTTTTTTTTTTTTGAGAGTGGAGTTAGATGTTCTTACCATAGAGTTTTACAGGGTTATAATAGCTTTCTTTACTGCATTATATGTAGAAGTGTA

GTGCAGTGCTTTTATCTGTAGCATTTAATTTTTTAATTTTCCATTTTTCAAGAATAGTTTCTGCTTTGTTAATATTTATACACAGGCTACTTGTTGAAGT

AATTAATTAAAAATATAACCAAGTGCCTAAGTCTTTCAGCTGATGTACTAGATATTAAATTCTCCTAAGTTATGCAGAATCGTTTTTACAATTTTGATAA

ATTATGCACTAATGTAATGGCAATTTTTTAAAATGCAGATTTAAGCCTGTACATTATTGAATCTGATGACTTGGCAAAAGAATCAGGTGCTTTCAGCTTT

CTTGAGAAAACCCTGTATGTAGCGTTTGCACTGACTAACAAGATGGTATTGCTGGGTCTTTAATTTAAAGAAATTAATTTGGGTGTTCATTGCATTATTT

AGTTAGATATTGTTTATTGTTACTTCATGTTGGGTTTAATTTTCTTGTTTTCTGACTGTTAGGTTGATAAGACTTTGAACCATGTAGTAGTAGAACATTG

GCTAACATTACCCATACTTAAAAACATGAATAATTTCTGCCCTGCCATAATGTGACTGAAATTTTCACTTGGCATCTGAAAGTATGCAGTATGTTCAACC

AGCTCTGCCCCAGATTTGTGGGTAGTAGTTTATTGAAGCTTAAATTTCAGTCAATATTTAAAAACAAAAGCAGGGCATGCCTTTCTGGTAGTAATCTAAT

AGTTTATCTTTTTGTTTTTCTTCCATTTCTTTAAGATTAGTTTGACTTTTATTATTTTTTAATTAACTTCTGTGAAGTTGTTTACTCTGAAAATTGTACT

GGAATATTTTAAGCCAAGCTGATCTTTCACCAGGTGTACTGTATGTAAGGGCTTCTCCTGCTAGCAAGATGCTTAAACAGGATCATGTTATTGGTCGTCT

GAGCTATTTAGTTATTTTACAAAAACCACAGCATTGTATCAGAGAAGATTTTGATAAAAGTTTTGTGCACATTTCCAGGGGTGGGAGGGTTAACATTTCC

CTGAAATTTCTTGATTGGAATGAGTAAATACTGGTGTTTGATACCTGTCTTAATGAACATGCTCATAAGGTGACTGATACGTTGTAAATAATACCTGAGA

AACAAAGGGGTAGTTTTGATATTCTGGTGTCAGTATGGAAGATCTTACACATTTATTTAATACTCAAGTGTATGAAGATGTTTGTTTATAACATAACAGC

ACAGTAGCCTTGACTTAGTTTTATTTGGTTAGTACTGTACCTTTTTGCCATGGCCAGTGCTCCCCATCCCTACAAAGACATTTTATTTATTTTACTCTGT

AACCTGAAATGAAGAGGAACAAGAGTTTTAAACCATGTTACATTAACTTATTTCTGACATTATAAATTAGCCTAGGATATTACAGGAACATGATTGTTAT

ATAATTTATATCAGAACCTTTCTATAAATATGAGCTTATTACATTTGAAATGTTTCCAATGTATTTTTCTTTTCCTTCTCTTCTCTTCTCTTCTCTTCTC

TCTTCTCTCTTCTCTCTTCTCTCTTCTCTCTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTTCTTTCTGTTTGTA

ATTCCAAAAAGGTTATGTAAACCAGTCTGTCTATTTCATGGATATTTAATAGTGAGATCTTCCATGTTGAAGGTAATGTATTTTTTTTTAAGATTTTAAA

ATTGCTATTTTGTTACAAAATAGAGACCTATTAACAGTTGAGAGCTCCTTATGTGCCCTCAGGGAAAGAACCCTCTGTGCAGCAGAGCTACACGAACATC

TTCAGCACTTTCTGAGGGTGATTATATACTACATAAATTGATCTTGTGTATTTAACCTTATCTTTTTAATTTTAAAGTTGAAATTTTGAAACGTGGTTGT

GCTCTTCTGGAGGGGTTGGGATGCTTAGGTGTTTGCCTACTTGTTCAGTAAACTGCATTTCATCAGTGTATGTGTACACCTGCCAACCTTATTGGTGTGT

CTCAAACATTTATAGGAAAATAGTGCTTGTCTTGCAGCAGATGATCCCATAAAACAATAACTTCTAATTCTTAAATGTTTACTCTTTCTCACTAACAACA

CAGGAATTGTTTCTGTGTTCACATTATTCTGTATTGCATTTTTTATGTGGTGACAGCTTACTGTATGTTTTAGTGGGTATAATTTGAAATAAGGCTATTG

GATCTCTGCCACTTAAGAAGAAAGAACAGTTCATCTGACCTTTCTTCAAAATGATACCTGCTGATGTCACAGAGGAAAATAGTACAAACAGACCTAGAAT

GTGTTTTTTTTTAATTGGGGCAATCATCACTTTGACCCTTTATCAAGATGACATGATGAACACATTTGGAATCAGAGGCTACAAAACAATAGAAGAGAAA

CTTTGTAATGTCGGTATCTAAAATGCTTGTAAAGCCTATGGGTCTAATCAGGAATCAGTAGTATGAAGTCTGAAAAAAAGCAGGGAAATGGTGTAGGTTT

CCTTATATTTTTTACCTGTCAGTTTTCGGAGTCCCAATTCCTAGTCTGTGTGCTGCATTCAGATGCTGTGAATATATCATTAGTTTTGTGTGGGCTTCTT

TTATTTTATGAATTCTAAGAGTTCTGTGTATATTTCTTCTAGTTGGTACCTACACAAATTAGATTTCTCTTGCTTTTGCCACTATGACTTATTTCAGTGC

CATGCAACGAGTCAGTGTATGTAGGGACAGGGACATTGTACATTGTAATTTTCAAGAAAAGGTATCTCTTAAGGCCCGTGGCACTGATTCTGCTTTCATA

GCTACTTACTCTACTAAGAGAATTCAATGAAACTTCATTTAAAAACTAAAATTTCCCATTGGTATGGATCGTAGTCACTTTGACCCAGATTTCAAGTTGA

TGCTAAGTTTACAAAGCACATCCTGATTTTATATACAGAAGATTACAGAATGCAATGATTTGTAGGACCTTTGAGTGGGATCATTTAACTATTTGAAAAA

ATTGTTTAAAAACCATCTACCCTATTTTTGCATTTTAGATGTGTTAAAGCCCATGTTGTCTTTTTAGCCAGGGATAGAACTTGTAACATCCAGATTCAGT

ATGTTAGTTGTAAATCTGAGTATTTCTTCCCTTGCATCTTTGAGTCATTTTCTAAGCAGACTGTCACCAATATTGGTAATTAATCATTAAAGAGAAAAGT

TGCATTGCAGCTATATATTAGTGTCTTAGAACTGTTCTTTTGTTTTAGTGAATAAAGAGTACCAATGGGATCACTTACTGTTAACTCCTTCTACTGAAGG

GCCCCTTCTGCAAGCAGAACACAAATGAACATGCTCAAGGAGTATCCCGTTTTCTAGAGATTAAGTTTGCTAGTAACTCCTTTACACTAGCTATTTCTTT

GTATCCCTTTGCTGGCAAGGGAGTACAAGGAGTCAAACCACAGATCAGAACACCCCACATTTGAGTGGAGACTTATTTTTACTCTAAGGGGAGTTATTCC

CCCAAGTCTGAAACTGGCAATTATTTTTTTTTCTCTTACATAAAAATTTAAAAATATCCCCCAAACCAGTGGAAAACAGACACTGGCTGCACTTAGTACT

GCCAAGAGCCAAGGTCATTTGCACATATTCCATCAACCTGTCAAAAATTAGGCCTCACTTTATAACCCAAGGCATGGAAGTGCATGCATTCTCTTAGCTG

GGCAAGCAATTATACTGTAGTTGTGATACAACACATGTGGCTTTTATTTGTACTGCACATACCCACTGTACAGCCACTTGGGAGTATCGTGGTTAGCTTG

CAGCAACTGCCGTCTGCATTTATACTGTTTATTGCATATTCTTTTCCCTGGAAGTGAAAGAGAAATGTTTTTCTTGTTGCATTGATTACATTTTATAAAT

TTGCTTAGCTGGAAAGTTTGGGAAAAGAGGCCTGTTTGTCAATTGTACAACCGATTGTGAAGCTTAGTGTGAATATTTTTACGTCTGTATTAGACATTTT

CTTTGCAAATCTATTGTTCGATTGAAATGTAAATGAAATTAAAGATGGTGTACACCCATCATGTAAAACGCAGGCACCATCTCTAAGATGGATTTAATGC

TCATTTTTAAGGCATATACTCAGCTTCTATTTAAAACTATAAAATAATTCTGTACAATGAAATGGGGAATATATATGGGAATAAATTCTATTCCATTTAT

TTCAATTTGAATTTCCAAATTGTAATGTTTCCCTTTGTGCTATAGGAATAGGATTAAATGGGGGAAGGCTAGGACTTATAAGGCCTGTATATGGGGGGAG

GGCAGAGATGGAACAATGAGGGTTGTGATGATAGTGAATAGCAAAGAGTGAATTCTGTGTGTTTTTGCTGTAGCACTGAAGTGAAGAGATATTAGCTTTG

GCTGTTCACAAAATAGAGCATCATGATTTTCAGTGTTTGAGAGAAAATTGATGGAAAAAGTTTGCAGTACTTGACATGTATTTGCATGCACAAAATAAAA

TTATTTGTCCACCTTAAAA
Translation
 - UNI25184 -  - UNI17386 - MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTDIDVLPVNFALLQ

LVGAQ VPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKG GVASLNQSALSRPMQRKLVTLVNCQLVEEEGRVRAMRAARSLGERTVTELILQ

HQNPQQLSANLWAAVRARGCQFLGPA AMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFK VTKRDEDSSLMQL

KEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDK LQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANIDPNPD

 DAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQ - UNI1827 - PQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK - UNI89

45 - KYRLRNKKMSATVRTFPLLNKVGVNSTVTTTAGNVISVIGSTETTGKIVASTNGISNTESSVSQLIPRGTDSAVRTLETVKKVGKVGTNAQNAGP

SAESVSEN NKIGSPPKTPVSNAAATSAGPSNFGTELNSLPPKSSPFLTRVPVYPQHSESIQYFQDPRTQIPFEVPQYPQTG GYYPPPPTVPAGVTPCV

PRFVRSSNVPESSLPPASMPYADHYSTFSPRDRMNSSPYQPPPPQQYGPVPPVPSGMYAPVYDSRRIWRPAMYQRDDIIRSNSLPPMDVMHSSVYQTSLR

ERYNSLDGYYSVACQPPNDPRTTVPLPR EPCGHLKTSCEEQLRRKPDQWTQYHTQKTPVSSTLPVATQSPTPPSPLFSVDFRSD FSESVSGAKFEEDH

LSHYSPWSCGTIGSCINAIDSEPKDVIANSNAVLM DLDSGDVKRRVHLFEAQRRTKEEDPIIPFSDGPIISKWGAISRSSRTGYHTTDPVQATASQGSA

TKPISVSD DYVPYVNAVDSRWSSYGNDATSSAHYIER RDRFIVTDLSGHRKHSSTGDLLSIELQQ AKSNSLLLQREANALAMQQKWNSLDEGRHLTL

NLLSKEIELRNGE NDYTEDTVDTKPDRDIELELSALDTDEPDGQSEQIE EILDIQLGISSQNDQLLNGTAVENGHPAQQHQKDPGKPKRQSLG GRSK

NQFCR
Transcript ENSMUST00000112936
Sequence
CCGCCGAGCTCTGCCCCGGCGAGACGAGGCGCCTCCGTCGCCGAGCCGCGCCGTCGCGGGGCCCCCGGGAGCGGCCCTTAGCGACCCCGCCCGGGCCCCT

CAG - UNI17386 - - UNI25184 - CTTAAAAAACACTACACATCAAAATAATGATCTGCTAGACTGCTAACCCGAGCATCAGCTTCCACAATGC

CTGTGCAGGCAGCTCAATGGACAGAGTTTCTGTCCTGTCCAATCTGCTATAATGAATTTGATGAGAATGTGCACAAACCCATCAGTTTAGGTTGTTCACA

CACAGTTTGCAAGACCTGCTTGAATAAACTTCACCGAAAAGCGTGTCCTTTTGACCAGACTGCCATAAACACAGACATTGATGTGCTCCCTGTCAACTTT

GCACTTCTTCAGTTAGTTGGAGCCCAG GTACCAGATCATCAGTCAATAAAGTTAAGTAATCTAGGTGAGAATAAACACTATGAAGTGGCAAAAAAATGC

GTAGAGGACTTGGCACTCTACTTAAAACCACTAAGTGGAGGTAAAG GTGTAGCTAGTTTGAACCAGAGTGCCCTGAGCCGTCCAATGCAAAGGAAACTA

GTTACACTTGTAAACTGTCAACTGGTGGAAGAAGAAGGTCGTGTCAGAGCTATGCGAGCGGCCCGTTCACTAGGAGAAAGAACTGTGACAGAACTGATAC

TGCAGCACCAGAACCCTCAGCAGCTGTCTGCCAACCTGTGGGCTGCTGTCAGGGCTCGAGGATGCCAGTTTCTAGGGCCAG CTATGCAAGAAGAAGCCT

TGAAGTTGGTATTGCTGGCATTAGAAGATGGTTCTGCTCTCTCTAGGAAAGTTCTAGTACTTTTTGTTGTGCAAAGACTAGAACCAAGATTTCCTCAGGC

ATCAAAAACAAGTATTGGCCATGTTGTGCAGCTATTGTACCGAGCTTCTTGTTTTAAG GTTACTAAAAGGGATGAAGACTCTTCCCTGATGCAGCTAAA

GGAGGAATTTCGGAGTTACGAGGCACTACGCAGAGAACATGATGCCCAGATTGTTCATATTGCCATGGAAGCAGGACTCCGTATTTCACCTGAGCAGTGG

TCTTCACTGCTGTATGGGGACTTGGCTCATAAATCACACATGCAGTCTATCATTGATAAG CTACAGTCTCCAGAATCATTTGCAAAGAGTGTCCAGGAA

TTGACAATTGTTTTGCAGCGAACTGGTGACCCTGCTAATTTAAATAGGCTGAGACCTCATTTAGAGCTTCTTGCAAACATAGACCCTAATCCAG ATGCT

GTTTCACCAACTTGGGAGCAACTGGAAAATGCAATGGTAGCTGTTAAAACAGTTGTTCATGGTCTTGTGGACTTCATACAAAATTATAGTAGAAAAGGCC

ATGAGACACCTCAG - UNI1827 - CCACAGCCAAACAGCAAGTATAAAACTAGTATGTGCCGAGATTTACGACAACAAGGGGGTTGTCCACGAGGAA

CAAATTGTACATTTGCCCATTCTCAGGAAGAGCTTGAAAA - UNI8945 - GTACCGATTAAGGAACAAAAAGATGAGCGCGACTGTAAGAACATTTC

CTCTTCTGAATAAAGTTGGTGTAAACAGCACTGTCACAACCACAGCCGGAAATGTCATTTCTGTCATAGGAAGTACTGAAACAACTGGGAAAATTGTTGC

AAGTACAAATGGAATTTCAAATACAGAAAGCAGTGTTTCTCAGCTAATCCCACGAGGCACTGACAGTGCAGTAAGGACTTTGGAGACTGTGAAGAAAGTC

GGGAAGGTTGGCACTAATGCTCAGAATGCTGGGCCCTCTGCAGAGTCCGTGTCTGAAAA TAAAATTGGTTCTCCACCCAAGACTCCTGTAAGTAATGCA

GCAGCTACCTCCGCTGGGCCCTCTAATTTTGGAACAGAGCTGAATTCCCTGCCTCCCAAATCCAGCCCATTTCTAACTAGAGTTCCAGTATATCCTCAGC

ATTCTGAAAGCATTCAGTATTTTCAAGATCCAAGGACTCAGATACCTTTTGAAGTCCCACAATACCCACAAACAG GATACTACCCACCACCTCCAACGG

TACCAGCTGGTGTGACTCCCTGTGTTCCTCGCTTTGTGAGGTCCAGTAATGTTCCAGAGTCCTCCCTCCCACCTGCTTCCATGCCATATGCTGATCATTA

CAGTACATTCTCCCCTCGAGATCGAATGAATTCTTCTCCTTACCAACCTCCTCCTCCGCAGCAGTATGGACCAGTTCCTCCAGTACCCTCTGGAATGTAT

GCTCCGGTGTATGACAGCAGGCGCATCTGGCGCCCAGCTATGTACCAACGAGATGACATTATTAGAAGCAATTCTTTACCTCCAATGGATGTGATGCACT

CATCTGTCTATCAGACATCTTTACGGGAAAGATACAACTCATTAGATGGATATTATTCAGTGGCTTGTCAGCCACCGAATGACCCAAGGACAACTGTGCC

TTTACCAAGG GAACCTTGTGGTCATTTGAAGACCAGTTGTGAGGAACAGTTAAGAAGAAAGCCAGATCAGTGGACACAGTATCATACCCAGAAAACACC

TGTCTCTTCAACTCTTCCTGTGGCCACACAGTCACCAACACCACCTTCTCCTCTATTCAGTGTAGACTTCCGATCGGAT TTCTCTGAGAGTGTGAGTGG

CGCAAAATTTGAGGAAGACCATCTTTCCCATTATTCTCCCTGGTCTTGTGGTACCATAGGCTCTTGTATAAATGCCATTGATTCGGAGCCCAAAGACGTA

ATTGCTAATTCAAATGCTGTATTGATG GACCTGGACAGTGGGGATGTAAAGAGAAGAGTGCATTTATTTGAAGCTCAGAGAAGGACAAAAGAAGAAGAC

CCAATTATTCCCTTTAGTGACGGACCCATTATCTCAAAATGGGGTGCAATTTCCCGATCCTCCCGAACAGGTTACCATACAACAGATCCCGTCCAGGCAA

CTGCTTCCCAAGGAAGTGCAACTAAGCCCATCAGCGTATCAG ATTATGTCCCTTACGTGAATGCTGTCGATTCAAGGTGGAGTTCATATGGCAACGATG

CTACATCATCAGCACACTATATTGAACG GGACAGATTCATTGTTACTGATTTATCTGGTCATAGAAAGCATTCTAGTACCGGAGACCTTTTGAGCATTG

AACTTCAGCAG GCCAAGAGTAACTCATTACTTCTTCAGAGGGAAGCTAATGCTCTGGCCATGCAACAAAAGTGGAATTCCCTGGATGAAGGCCGTCACC

TTACTTTAAATCTTCTAAGCAAGGAAATTGAACTAAGAAATGGAGAG AATGACTACACAGAAGACACTGTAGATACAAAGCCTGATAGGGATATTGAGT

TAGAGCTTTCAGCCCTTGATACTGATGAACCTGATGGCCAGAGTGAACAAATTGAA GAAATTTTGGACATACAACTTGGTATCAGTTCTCAAAATGACC

AGTTGCTCAATGGAACAGCAGTGGAAAATGGTCATCCAGCCCAGCAGCACCAGAAGGACCCAGGAAAGCCGAAGAGACAGAGTTTAGGTGAAGACCATGT

GATTCT GGAGGAGCAAAAACCAATTCTGCCGGTAACATCTTGCTTTAGCCAGCCACGTCCAATGTCTATTAGCAGTGCAAGCTGCCTCCCCATCACCAC

ATCTGTCAGTGTTGGCAACCTCATTCTGAAAACTCACGTTATGTCTGAAGATAAAAACGACTTTTTAAAACCTATTGCAAATGGGAAGATGGTTAACAGC

TGAAAGGAGGCTCAGCTTTCAAATCTGTGACCACACCATGGAAGCATTTACACTAGCTTTTTATATATATAATATATATTATATAATGTATATTTTTTTT

AAAAAAAAAGATATTACTGGGGGCATCCATTTCCTGTGGACTCTTTGATACTTCAAGCCCTCTTGCATTAGCATTATGAAAAAAAAGAAAATTTACTTTA

CTAGGGTAATGTTCACTTTCCAGAAATTATTGGAATTTGGACAACATTTAACTTAAGCTTCAAGCAGCTTTTTATGAGTTTGTAGCAATCCGGTGCAGTA

ACTGAGCCATTTCCTATTTTAAATGGCTTCTACAGTAAATTAACAACTCAGTTATTAAACTAGCAGGATCCTACAATGATACATCTAGTGAAAGTAGAGT

TAATTAACTTATTTCTATTTTATGTTTCACTGAGAGAAATTTCCATCTCATTCCAGCTGCTTTATTTATCTTTTTCATTGGACTTTGCATGGATTTTTCT

TTCTTTCTTTTTTTGTTTTGTTTTGTTTTGTTTTTCCTTTTCTTTTCTGTCTTTTTTTTTTTTTTTTGAGAGTGGAGTTAGATGTTCTTACCATAGAGTT

TTACAGGGTTATAATAGCTTTCTTTACTGCATTATATGTAGAAGTGTAGTGCAGTGCTTTTATCTGTAGCATTTAATTTTTTAATTTTCCATTTTTCAAG

AATAGTTTCTGCTTTGTTAATATTTATACACAGGCTACTTGTTGAAGTAATTAATTAAAAATATAACCAAGTGCCTAAGTCTTTCAGCTGATGTACTAGA

TATTAAATTCTCCTAAGTTATGCAGAATCGTTTTTACAATTTTGATAAATTATGCACTAATGTAATGGCAATTTTTTAAAATGCAGATTTAAGCCTGTAC

ATTATTGAATCTGATGACTTGGCAAAAGAATCAGGTGCTTTCAGCTTTCTTGAGAAAACCCTGTATGTAGCGTTTGCACTGACTAACAAGATGGTATTGC

TGGGTCTTTAATTTAAAGAAATTAATTTGGGTGTTCATTGCATTATTTAGTTAGATATTGTTTATTGTTACTTCATGTTGGGTTTAATTTTCTTGTTTTC

TGACTGTTAGGTTGATAAGACTTTGAACCATGTAGTAGTAGAACATTGGCTAACATTACCCATACTTAAAAACATGAATAATTTCTGCCCTGCCATAATG

TGACTGAAATTTTCACTTGGCATCTGAAAGTATGCAGTATGTTCAACCAGCTCTGCCCCAGATTTGTGGGTAGTAGTTTATTGAAGCTTAAATTTCAGTC

AATATTTAAAAACAAAAGCAGGGCATGCCTTTCTGGTAGTAATCTAATAGTTTATCTTTTTGTTTTTCTTCCATTTCTTTAAGATTAGTTTGACTTTTAT

TATTTTTTAATTAACTTCTGTGAAGTTGTTTACTCTGAAAATTGTACTGGAATATTTTAAGCCAAGCTGATCTTTCACCAGGTGTACTGTATGTAAGGGC

TTCTCCTGCTAGCAAGATGCTTAAACAGGATCATGTTATTGGTCGTCTGAGCTATTTAGTTATTTTACAAAAACCACAGCATTGTATCAGAGAAGATTTT

GATAAAAGTTTTGTGCACATTTCCAGGGGTGGGAGGGTTAACATTTCCCTGAAATTTCTTGATTGGAATGAGTAAATACTGGTGTTTGATACCTGTCTTA

ATGAACATGCTCATAAGGTGACTGATACGTTGTAAATAATACCTGAGAAACAAAGGGGTAGTTTTGATATTCTGGTGTCAGTATGGAAGATCTTACACAT

TTATTTAATACTCAAGTGTATGAAGATGTTTGTTTATAACATAACAGCACAGTAGCCTTGACTTAGTTTTATTTGGTTAGTACTGTACCTTTTTGCCATG

GCCAGTGCTCCCCATCCCTACAAAGACATTTTATTTATTTTACTCTGTAACCTGAAATGAAGAGGAACAAGAGTTTTAAACCATGTTACATTAACTTATT

TCTGACATTATAAATTAGCCTAGGATATTACAGGAACATGATTGTTATATAATTTATATCAGAACCTTTCTATAAATATGAGCTTATTACATTTGAAA
Translation
 - UNI17386 - - UNI25184 - MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTDIDVLPVNFALLQL

VGAQ VPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKG GVASLNQSALSRPMQRKLVTLVNCQLVEEEGRVRAMRAARSLGERTVTELILQH

QNPQQLSANLWAAVRARGCQFLGPA AMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFK VTKRDEDSSLMQLK

EEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDK LQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANIDPNPD 

DAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQ - UNI1827 - PQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK - UNI894

5 - KYRLRNKKMSATVRTFPLLNKVGVNSTVTTTAGNVISVIGSTETTGKIVASTNGISNTESSVSQLIPRGTDSAVRTLETVKKVGKVGTNAQNAGPS

AESVSEN NKIGSPPKTPVSNAAATSAGPSNFGTELNSLPPKSSPFLTRVPVYPQHSESIQYFQDPRTQIPFEVPQYPQTG GYYPPPPTVPAGVTPCVP

RFVRSSNVPESSLPPASMPYADHYSTFSPRDRMNSSPYQPPPPQQYGPVPPVPSGMYAPVYDSRRIWRPAMYQRDDIIRSNSLPPMDVMHSSVYQTSLRE

RYNSLDGYYSVACQPPNDPRTTVPLPR EPCGHLKTSCEEQLRRKPDQWTQYHTQKTPVSSTLPVATQSPTPPSPLFSVDFRSD FSESVSGAKFEEDHL

SHYSPWSCGTIGSCINAIDSEPKDVIANSNAVLM DLDSGDVKRRVHLFEAQRRTKEEDPIIPFSDGPIISKWGAISRSSRTGYHTTDPVQATASQGSAT

KPISVSD DYVPYVNAVDSRWSSYGNDATSSAHYIER RDRFIVTDLSGHRKHSSTGDLLSIELQQ AKSNSLLLQREANALAMQQKWNSLDEGRHLTLN

LLSKEIELRNGE NDYTEDTVDTKPDRDIELELSALDTDEPDGQSEQIE EILDIQLGISSQNDQLLNGTAVENGHPAQQHQKDPGKPKRQSLGEDHVIL

 LEEQKPILPVTSCFSQPRPMSISSASCLPITTSVSVGNLILKTHVMSEDKNDFLKPIANGKMVNS
Transcript ENSMUST00000100143
Sequence
AGCTTAAAAAACACTACACATCAAAATAATGATCTGCTAGACTGCTAACCCGAGCATCAGCTTCCACAATGCCTGTGCAGGCAGCTCAATGGACAGAGTT

TCTGTCCTGTCCAATCTGCTATAATGAATTTGATGAGAATGTGCACAAACCCATCAGTTTAGGTTGTTCACACACAGTTTGCAAGACCTGCTTGAATAAA

CTTCACCGAAAAGCGTGTCCTTTTGACCAGACTGCCATAAACACAGACATTGATGTGCTCCCTGTCAACTTTGCACTTCTTCAGTTAGTTGGAGCCCAG 

GTACCAGATCATCAGTCAATAAAGTTAAGTAATCTAGGTGAGAATAAACACTATGAAGTGGCAAAAAAATGCGTAGAGGACTTGGCACTCTACTTAAAAC

CACTAAGTGGAGGTAAAG GTGTAGCTAGTTTGAACCAGAGTGCCCTGAGCCGTCCAATGCAAAGGAAACTAGTTACACTTGTAAACTGTCAACTGGTGG

AAGAAGAAGGTCGTGTCAGAGCTATGCGAGCGGCCCGTTCACTAGGAGAAAGAACTGTGACAGAACTGATACTGCAGCACCAGAACCCTCAGCAGCTGTC

TGCCAACCTGTGGGCTGCTGTCAGGGCTCGAGGATGCCAGTTTCTAGGGCCAG CTATGCAAGAAGAAGCCTTGAAGTTGGTATTGCTGGCATTAGAAGA

TGGTTCTGCTCTCTCTAGGAAAGTTCTAGTACTTTTTGTTGTGCAAAGACTAGAACCAAGATTTCCTCAGGCATCAAAAACAAGTATTGGCCATGTTGTG

CAGCTATTGTACCGAGCTTCTTGTTTTAAG GTTACTAAAAGGGATGAAGACTCTTCCCTGATGCAGCTAAAGGAGGAATTTCGGAGTTACGAGGCACTA

CGCAGAGAACATGATGCCCAGATTGTTCATATTGCCATGGAAGCAGGACTCCGTATTTCACCTGAGCAGTGGTCTTCACTGCTGTATGGGGACTTGGCTC

ATAAATCACACATGCAGTCTATCATTGATAAG CTACAGTCTCCAGAATCATTTGCAAAGAGTGTCCAGGAATTGACAATTGTTTTGCAGCGAACTGGTG

ACCCTGCTAATTTAAATAGGCTGAGACCTCATTTAGAGCTTCTTGCAAACATAGACCCTAATCCAG ATGCTGTTTCACCAACTTGGGAGCAACTGGAAA

ATGCAATGGTAGCTGTTAAAACAGTTGTTCATGGTCTTGTGGACTTCATACAAAATTATAGTAGAAAAGGCCATGAGACACCTCAG - UNI1827 - C

CACAGCCAAACAGCAAGTATAAAACTAGTATGTGCCGAGATTTACGACAACAAGGGGGTTGTCCACGAGGAACAAATTGTACATTTGCCCATTCTCAGGA

AGAGCTTGAAAA - UNI8945 - GTACCGATTAAGGAACAAAAAGATGAGCGCGACTGTAAGAACATTTCCTCTTCTGAATAAAGTTGGTGTAAACAG

CACTGTCACAACCACAGCCGGAAATGTCATTTCTGTCATAGGAAGTACTGAAACAACTGGGAAAATTGTTGCAAGTACAAATGGAATTTCAAATACAGAA

AGCAGTGTTTCTCAGCTAATCCCACGAGGCACTGACAGTGCAGTAAGGACTTTGGAGACTGTGAAGAAAGTCGGGAAGGTTGGCACTAATGCTCAGAATG

CTGGGCCCTCTGCAGAGTCCGTGTCTGAAAA TAAAATTGGTTCTCCACCCAAGACTCCTGTAAGTAATGCAGCAGCTACCTCCGCTGGGCCCTCTAATT

TTGGAACAGAGCTGAATTCCCTGCCTCCCAAATCCAGCCCATTTCTAACTAGAGTTCCAGTATATCCTCAGCATTCTGAAAGCATTCAGTATTTTCAAGA

TCCAAGGACTCAGATACCTTTTGAAGTCCCACAATACCCACAAACAG GATACTACCCACCACCTCCAACGGTACCAGCTGGTGTGACTCCCTGTGTTCC

TCGCTTTGTGAGGTCCAGTAATGTTCCAGAGTCCTCCCTCCCACCTGCTTCCATGCCATATGCTGATCATTACAGTACATTCTCCCCTCGAGATCGAATG

AATTCTTCTCCTTACCAACCTCCTCCTCCGCAGCAGTATGGACCAGTTCCTCCAGTACCCTCTGGAATGTATGCTCCGGTGTATGACAGCAGGCGCATCT

GGCGCCCAGCTATGTACCAACGAGATGACATTATTAGAAGCAATTCTTTACCTCCAATGGATGTGATGCACTCATCTGTCTATCAGACATCTTTACGGGA

AAGATACAACTCATTAGATGGATATTATTCAGTGGCTTGTCAGCCACCGAATGACCCAAGGACAACTGTGCCTTTACCAAGG GAACCTTGTGGTCATTT

GAAGACCAGTTGTGAGGAACAGTTAAGAAGAAAGCCAGATCAGTGGACACAGTATCATACCCAGAAAACACCTGTCTCTTCAACTCTTCCTGTGGCCACA

CAGTCACCAACACCACCTTCTCCTCTATTCAGTGTAGACTTCCGATCGGAT TTCTCTGAGAGTGTGAGTGGCGCAAAATTTGAGGAAGACCATCTTTCC

CATTATTCTCCCTGGTCTTGTGGTACCATAGGCTCTTGTATAAATGCCATTGATTCGGAGCCCAAAGACGTAATTGCTAATTCAAATGCTGTATTGATG 

GACCTGGACAGTGGGGATGTAAAGAGAAGAGTGCATTTATTTGAAGCTCAGAGAAGGACAAAAGAAGAAGACCCAATTATTCCCTTTAGTGACGGACCCA

TTATCTCAAAATGGGGTGCAATTTCCCGATCCTCCCGAACAGGTTACCATACAACAGATCCCGTCCAGGCAACTGCTTCCCAAGGAAGTGCAACTAAGCC

CATCAGCGTATCAG ATTATGTCCCTTACGTGAATGCTGTCGATTCAAGGTGGAGTTCATATGGCAACGATGCTACATCATCAGCACACTATATTGAACG

 GGACAGATTCATTGTTACTGATTTATCTGGTCATAGAAAGCATTCTAGTACCGGAGACCTTTTGAGCATTGAACTTCAGCAG GCCAAGAGTAACTCAT

TACTTCTTCAGAGGGAAGCTAATGCTCTGGCCATGCAACAAAAGTGGAATTCCCTGGATGAAGGCCGTCACCTTACTTTAAATCTTCTAAGCAAGGAAAT

TGAACTAAGAAATGGAGAG AATGACTACACAGAAGACACTGTAGATACAAAGCCTGATAGGGATATTGAGTTAGAGCTTTCAGCCCTTGATACTGATGA

ACCTGATGGCCAGAGTGAACAAATTGAA GAAATTTTGGACATACAACTTGGTATCAGTTCTCAAAATGACCAGTTGCTCAATGGAACAGCAGTGGAAAA

TGGTCATCCAGCCCAGCAGCACCAGAAGGACCCAGGAAAGCCGAAGAGACAGAGTTTAGGTGAAGACCATGTGATTCT GGAGGAGCAAAAACCAATTCT

GCCGGTAACATCTTGCTTTAGCCAGCCACGTCCAATGTCTATTAGCAGTGCAAGCTGCCTCCCCATCACCACATCTGTCAGTGTTGGCAACCTCATTCTG

AAAACTCACGTTATGTCTGAAGATAAAAACGACTTTTTAAAACCTATTGCAAATGGGAAGATGGTTAACAGCTGAAAGGAGGCTCAGCTTTCAAATCTGT

GACCACACCATGGAAGCATTTACACTAGCTTTTTATATATATAATATATATTATATAATGTATATTTTTTTTAAAAAAAAAGATATTACTGGGGGCATCC

ATTTCCTGTGGA
Translation
MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTDIDVLPVNFALLQLVGAQ VPDHQSIKLSNLGENKHYEVAK

KCVEDLALYLKPLSGGKG GVASLNQSALSRPMQRKLVTLVNCQLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANLWAAVRARGCQFLGPA A

MQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFK VTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLR

ISPEQWSSLLYGDLAHKSHMQSIIDK LQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANIDPNPD DAVSPTWEQLENAMVAVKTVVHGLVDF

IQNYSRKGHETPQ - UNI1827 - PQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK - UNI8945 - KYRLRNKKMSATVRTFPLLNKVG

VNSTVTTTAGNVISVIGSTETTGKIVASTNGISNTESSVSQLIPRGTDSAVRTLETVKKVGKVGTNAQNAGPSAESVSEN NKIGSPPKTPVSNAAATSA

GPSNFGTELNSLPPKSSPFLTRVPVYPQHSESIQYFQDPRTQIPFEVPQYPQTG GYYPPPPTVPAGVTPCVPRFVRSSNVPESSLPPASMPYADHYSTF

SPRDRMNSSPYQPPPPQQYGPVPPVPSGMYAPVYDSRRIWRPAMYQRDDIIRSNSLPPMDVMHSSVYQTSLRERYNSLDGYYSVACQPPNDPRTTVPLPR

 EPCGHLKTSCEEQLRRKPDQWTQYHTQKTPVSSTLPVATQSPTPPSPLFSVDFRSD FSESVSGAKFEEDHLSHYSPWSCGTIGSCINAIDSEPKDVIA

NSNAVLM DLDSGDVKRRVHLFEAQRRTKEEDPIIPFSDGPIISKWGAISRSSRTGYHTTDPVQATASQGSATKPISVSD DYVPYVNAVDSRWSSYGND

ATSSAHYIER RDRFIVTDLSGHRKHSSTGDLLSIELQQ AKSNSLLLQREANALAMQQKWNSLDEGRHLTLNLLSKEIELRNGE NDYTEDTVDTKPDR

DIELELSALDTDEPDGQSEQIE EILDIQLGISSQNDQLLNGTAVENGHPAQQHQKDPGKPKRQSLGEDHVIL LEEQKPILPVTSCFSQPRPMSISSAS

CLPITTSVSVGNLILKTHVMSEDKNDFLKPIANGKMVNS

For any suggestions or comments, please send an email to unitrap@crg.es