Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075413 (Gm920)
Chromosomal location
Chr 15: 99776152 - 99797492 (-)
Description
gene model 920, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2685766]
UniGene
Mm.61024 
MGI
MGI:2685766 
Uniprot/SPTREMBL
Q3V0D7 
Human Ortholog
not available
Omim not available
UniTrap UNI23180
Vector Insertion
Chr 15: 99786091 - 99797180
Public Clones not available
Private Clones OST273618 (lexicon) OST203674 (lexicon) OST200752 (lexicon) OST193053 (lexicon)
OST112279 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21943
Vector Insertion
Chr 15: 99785352 - 99785873
Public Clones CMHD-GT_490E8-3 (cmhd)
Private Clones OST313453 (lexicon) OST210821 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100209
Sequence
AGTGTTCCTTGTAACCTCGGGAGTCCTTGAAGCTTCCTAGTGGACACTTAGTAGCATTTGTTTATATTCTGTGAAAAACAGAATAGAAACAAAGAAATCA

CCCAAATTTTCAAAATGCCTGTCAAAAGGCAGAGCAAAGTCTACTATGAATCTGACTCAGATGATGATGATGATGAATTCAAGGAACTTGCCACGTTGAG

AAAGCCCATAAGCAACCGTGATAATCCACTGAGCTTGCAATTTGAGATCCCAGCATCAGTACAGTCAGTCATCCATAAGATTGAGGAATCACATATCTTT

CGGGCCAAAGAG - UNI23180 - GAAGTTATTTGGAGGCTGACTGAAATAATGAGCAACGTGGAGCTGATAATGACTCGGTATAATATCGACAGCAT

GTCCCCTGGGAGGAAGGGTTCCAGCTCAGAAAGCCAGAAAAAGAAGAGAAAGGCTTTTTTAGAAAAGATTGCCACAGTTATGACGAATGTTGACCTTAGA

GAAAGGACTCTCTCCAAGATTCTGTCCTGGCTAGAAGAATGGA - UNI21943 - ATCTTATTCTGTCCGAGGTGTCTGCCATCAACATGGATGACTA

CTACCACTGGACTGTGAAGATGGAGCTGATACCAGACACGCTGAAAAGGATCAGCAAGAATGTCGACTCTCTGATTCAAATGGCCTTATTACTCGTGGAA

GAGAAGAAGAGAGCGAAGAAAAGAATAT TGGCTAGAGGCACTCTCTGGAAAGCTTGGAAAGACCGAGCTATAAAGCGGCCTGCCACAGCCCAAGCTTTA

AGACTAGATCAGATGATTTTTGACCAGATCGGCTTAAACGCTAAGGTTTCAGAGATTCAGGGCATGCTGCAGGAGCTCATCGGCACAGCGATGTTCAGCA

AGCTGGAAAATACTGCCATTAAATACATGTCCACCACAGTCATCAATCTCTCCAAGGCCCTGAACACCGTCAGCGATGAACTAAAACTCGTGAGCTCTCG

AGTGGTCAAGTCTGTTCTGAAGGAAGAGCAAGAGGAAGATAAGGAGAAAGACCGCTCCAAGCAGGTCATCCAAGAACTCAGCGAGGAGAACGAGATGCTC

CAGCAGAAACTTAGAGAATCCGAAGAAAAATGCGACCAACTTATTCGCATCAAAAATTATCTTGGACGCCAGATGATACACCCGGCTGGGTCCTTGAAAA

TACTGCCTTTACAGGGGCCGTTTTTCAGCAGGGAGTCCAGGGACTCTGAGAGGGAAGGAAAGACAGACGACTCCCAGAAGGAAGGGACCAAAAGCTCCAC

AGTGACATGGGACCCATCTTCCAGTGAAGGGGCTCCGGATGCAGCTAAGCAGCAAGTTGAGGACAAAGCTGAGGCCCCCCAAGACCAGATAAAACTCAAA

GGCCTGCCACTGACAGAGGAGACCTTGGACACAAATCTGGAAACGGAGGAAAAGAAACTCACTCAACTGGATATTCTAAAAGCAATGGACAAGAAGAAAG

TGGGTAAAGCAAAGGCCGAGCAAGGCAGAGGGGGACCAAGTCCCATGTGGGAACAACTCAAGAAGGGCAGATCTGAGCAGCTGATTCCAGGCAGCACAGG

CTCACCAGAGAGTAGAGAGTCCACCCTTAAATTAACAGACAAAGAAGCCAAGAGTGAAATAGATCTGCTTCAGCCTGAGGGTACCCCAGAGCTACAAAAA

CCAGAAACAAAGTGGAAAAGACTCATAGCAAAAACTGAAGAAACAAAACGGTCTGGTAAGTTACAACCCAAGACTTCTAAGGTGACTTCAGTAACCCCTG

ATGAAGGTGAGCAGGGCAGTCTAGAATCATTTCAAAGAGCCATCCTGGCCTTCCTGAGAGAGAAGACGAATAATGTAGGAAAGGCTTTTGATCCAAAGAG

TATACGGAAGGAGGAGTCGTCACTGGGAAAAGCAGAAGTTGAAAATTTAAACGTCATAAAGGCAAAAATAGAGGAATATTTCCAAAAAGTGGCTGAAACT

GTGACTGTAGCCTTGAGGACATACAGAGATGAAAGAAAGGTTCAACCTAAAGAGAAGCCCAAGAAACAGCCAAAGGGAGCACTGTCACGGATGCTTCCTA

AGCAGGGGGCGGTCGGCGCCAAGTCTGAGGTTGGCAGAGTTCTCCTCAGTGAGATCACAGACCCAGCAATTAAGAAACTGGTACAGATGCTCTTAAATGA

GATAGAGAGTGACTTCAAATACAAAACGACGAAGGAACAGCCACAGGCGGCGGTGGCGGCAGCGGCAGCGGCAGCGGCTGTGCAGAAGGAAGAGCCAGGA

CTGAGGACGAAGGACAAAACGGAGCTGCTGGAGGTGTGGATGCAAGCATTCAAAGACTCACAAGGCCACCAGGTTCAGGACCTGGGAGATGCAGAGGATG

CAGAAAAGCCGAAGTGGAGCGAGCCGGGTCATCAGGACCTGTGGAAGGGTGTCAGCAAGACCTCCATCAATCTAACTCCCAGGCTGATGAAGGCCCCGAA

ACCGCAGATAAGTCAGGCGCAGGCGCTCCAGGTGGAGCCTGGTGTAATGGGGGCCACGGAGGAACAGCAGCCCAAACTCACTCTCTCCTCTTCCAGAATC

CCCTTCGTTTCTCCAAAGCCCCACCAAGTGCATGTCCCTGAGCAGGCCCAGATAATAGGCCCTCAGATGTCCCCTCAGCTTTCAATGGCATCTCTCACCT

CTGAGCAGGCACAAACTTTGAGTGGTCCTCTTACTCATGAACACACTATAGAATTAAAGACTGCTTTCACAGCAGGGCAGGAGC
Translation
MPVKRQSKVYYESDSDDDDDEFKELATLRKPISNRDNPLSLQFEIPASVQSVIHKIEESHIFRAKE - UNI23180 - EVIWRLTEIMSNVELIMTRY

NIDSMSPGRKGSSSESQKKKRKAFLEKIATVMTNVDLRERTLSKILSWLEEWN - UNI21943 - NLILSEVSAINMDDYYHWTVKMELIPDTLKRIS

KNVDSLIQMALLLVEEKKRAKKRIL LARGTLWKAWKDRAIKRPATAQALRLDQMIFDQIGLNAKVSEIQGMLQELIGTAMFSKLENTAIKYMSTTVINL

SKALNTVSDELKLVSSRVVKSVLKEEQEEDKEKDRSKQVIQELSEENEMLQQKLRESEEKCDQLIRIKNYLGRQMIHPAGSLKILPLQGPFFSRESRDSE

REGKTDDSQKEGTKSSTVTWDPSSSEGAPDAAKQQVEDKAEAPQDQIKLKGLPLTEETLDTNLETEEKKLTQLDILKAMDKKKVGKAKAEQGRGGPSPMW

EQLKKGRSEQLIPGSTGSPESRESTLKLTDKEAKSEIDLLQPEGTPELQKPETKWKRLIAKTEETKRSGKLQPKTSKVTSVTPDEGEQGSLESFQRAILA

FLREKTNNVGKAFDPKSIRKEESSLGKAEVENLNVIKAKIEEYFQKVAETVTVALRTYRDERKVQPKEKPKKQPKGALSRMLPKQGAVGAKSEVGRVLLS

EITDPAIKKLVQMLLNEIESDFKYKTTKEQPQAAVAAAAAAAAVQKEEPGLRTKDKTELLEVWMQAFKDSQGHQVQDLGDAEDAEKPKWSEPGHQDLWKG

VSKTSINLTPRLMKAPKPQISQAQALQVEPGVMGATEEQQPKLTLSSSRIPFVSPKPHQVHVPEQAQIIGPQMSPQLSMASLTSEQAQTLSGPLTHEHTI

ELKTAFTAGQE

For any suggestions or comments, please send an email to unitrap@crg.es