Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075427 (Olfr287)
Chromosomal location
Chr 15: 98016448 - 98051408 (-)
Description
olfactory receptor 288 Gene [Source:MGI Symbol;Acc:MGI:3030122]
RefSeq_peptide
NP_001011733.2 NP_001011780.1 
UniGene
Mm.432690 
MGI
MGI:3030121 MGI:3030122 
Uniprot/SPTREMBL
Q3US77 Q3UUG0 Q7TS14 Q7TS15 Q8K503 
Human Ortholog
ENSG00000172640 (OR10AD1)
Omim not available
UniTrap UNI30512
Vector Insertion
Chr 15: 98019564 - 98040555
Public Clones IST11391G12BBF2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088331
Sequence
GAGAGAGGAGGAAGAGCAGGGAGGAGAGGAGCCCAGGCCCACAGCCCTATAAATGCACAGCTCATCTGCAGCAAATACCCTGCACCCTCACCCTGAACCT

CTGGATCACTCTTCTGCATCCAAGACCAGCACAATGCCCTCATCAGCCTGTCCCAAACCCCACGGTCAAG - UNI30512 - AGTGGCCCACCAGCTC

AGACCATCCTCCCTGGAGCAGCTCTTCCTCAAACAACATGCCATCTCTGTTTCTCGGGACAGCGATTCAGTGACACGGCCTGAGCAGCAAAGCCACGGGA

TGAG - UNI30512 - AGTGGCCCACCAGCTCAGACCATCCTCCCTGGAGCAGCTCTTCCTCAAACAACATGCCATCTCTGTTTCTCGGGACAGCGAT

TCAGTGAAACGGCCTGAGCAGCTAAGCCACGGGATGAG - UNI30512 - GTCCCAGACAGCAGACCCGAAGAACAGCAGCAGCACTGTGACTGAGTT

CATCCTCGTGGGCTTTGAGCAGAGCTCCCCTTCCACACGGGCATTGCTCTTCACCCTCTTCCTGGCTCTCTACAGCCTCGCCATGGCCATGAATGGCCTC

ATCATCTTCATCACATGGACTGACCCCAGGCTCAACAGCCCCATGTACTTCTTCCTTGGACACCTGTCTTTCCTGGACGTCTGCTTCATCACCACCACCA

TCCCGCAGATGTTGGTCCATCTGGTGACCAAGAACCACACTGTCTCCTTTGTCTCTTGCATGACCCAGATGTACTTGGTCTTTCTAGTGGGTGTGGCCGA

GTGCATCCTCTTGGCTTTCATGGCCTATGATCGTTATGTTGCCATCTGCCACCCACTGAACTATGCCCAGATCATGAGCCAGAAGGTGTGTGTCAGGCTG

GTGTGTTCTTCCTGGATCTTTGGGATGGTCAATGGTATCTTTCTTGAGTATATATCATTCAGGAATCCCTTCTGCAAAGACAACCACATAGAGAACTTCT

TCTGTGAGGCTCCCATAGTGATCGCTCTCTCCTGCGGGGACCTCAAGTTCACCATGAAGTTGATCTTTGTGGATGCCATTGTGGTGTTGCTCAGTCCCAT

GGTGCTCATCATCACCTCCTATGCCCGCATCCTGGCCTCCATCCTCCACAGGGCCTCCTCCTCAAGCCATAGGAAGACCTTTTCTACTTGTGCCTCCCAC

CTGACTGTGGTCATCTTTTTGTACACTTCAGCCATGTTTTCTTACATGAATCCCCGCAGTACACATGGGCCTGACAAAGACAAGTCTTTCTCCCTCCTCT

ATACCATCATCATGCCCATGTGCAACCCGGTCATCTACAGCTTCCGCAACAAGGAAATGAAGGGGGCCATGGGGCGGGCTCTTGGGAGAGGCAGCCTGGC

TTAGGCAGGATCTGCCCAGAAGGAGGGTGTCTGGAGAAGTTTCCTCAGTAGGGAGAAGGTTGCTTTTCTCAGCACCTCGCTTTTCAATTCTGGGGAAGCT

CTAAAAAGGAGCCTTGCCACTAGACTCAGACCTAGAAGTTCTTCCTGATGTCTCAGGCTCATTTCTGACTTTATTTCCAGAATTGTTTTTCCCATGAATT

TTCTTTAAGGAGACGTGAGGCTTTCCTGACTAGTTCCTCTGTGTTCCGCAAGAGTCAATGAGTATTTAACTCTATCTTGTCTGTATAGTTCTTTTACATG

CCATCCCCTGGGGGAACTTTTTGCACATACATTTAGGAATAAGTGACTTTTCAATCTTTTAATATGCCATATTAGACTTGGTATTGGAAACAAAGCAGAC

ATGTAGATTACTGGAATTGATTAGAGGGTAGAATTCTATGTAACTTTAGCCATCTGAGTTTTGACAGATGCCTTGGTAGTGCATGTCACCAACTACACAG

GATCTACAGGTGCCTGGGAAGCAAGCCTCCATACTTCTGAGGGATTATTTAACCTCTGATCAGGCCCATGAAGAATTATGTTGATTAAGTGAACTGAGGT

TGGGAAATCCACACTACAAGTAGGCAGGACCATTCCTGGTTCCGTATAAAACCCAGCAAGCTAGCAGAGTAAGGTCAGTCATCCACTGTTTCCCGTGTAT

AGATACAACGTGATCAGTCATCCACTGTTTCCTGTGTGTAGATACATGATCCTGCCACTTTATCTTCCCTGCCAGAATGGACAGTTTGCTCTTCAACTAT

AAACTGCAATAAACTCCTTTTCTTTT
Translation
 - UNI30512 - MR - UNI30512 - RVAHQLRPSSLEQLFLKQHAISVSRDSDSVKRPEQLSHGMR - UNI30512 - RSQTADPKNSSSTVT

EFILVGFEQSSPSTRALLFTLFLALYSLAMAMNGLIIFITWTDPRLNSPMYFFLGHLSFLDVCFITTTIPQMLVHLVTKNHTVSFVSCMTQMYLVFLVGV

AECILLAFMAYDRYVAICHPLNYAQIMSQKVCVRLVCSSWIFGMVNGIFLEYISFRNPFCKDNHIENFFCEAPIVIALSCGDLKFTMKLIFVDAIVVLLS

PMVLIITSYARILASILHRASSSSHRKTFSTCASHLTVVIFLYTSAMFSYMNPRSTHGPDKDKSFSLLYTIIMPMCNPVIYSFRNKEMKGAMGRALGRGS

LA

For any suggestions or comments, please send an email to unitrap@crg.es