Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075482 (Gm757)
Chromosomal location
Chr 2: 25089996 - 25092307 (-)
Description
gene model 757, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2685603]
Human Ortholog
not available
Omim not available
UniTrap UNI37028
Vector Insertion
Chr 2: 25091861 - 25092151
Public Clones CMHD-GT_193B4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091318
Sequence
ACTCTAGCTTGATGCTGCCACCACCTGCCTCCTGCCGTCTTGCCCGTGTAGATAGTAATGCGAACCCAAGGAGGGAGCCATGAGGTGTCCAGGGTCCCCA

CCCCCTCCTCCAACAATCCTCTAGCTTGGAATAGCTTTCTGGTGAAGCGGATGCAG - UNI37028 - GATGCTGCAGCCTGAAGGCCTCTATGCCTT

GGAGGAGGGGACAGCCCTGACAGCCTCACGGAATGACTGCATCATCTGCTACTCTGCCTATGACCTCTCAGTACACTTGCCTCGACGTCTCTACTGTGGC

CACACCTTCTGCCAGGCATGCATGCAGCGGCTGGATATGCCAGCCCACGAACAACACTGGATCCCCTGTCCACAGTGCCGACAAAGTACCCCTGTGCCCC

GTGGAGGGGTGACCATGTTGGACCTGGACCTGGCTGCCTTCTTGGCAGTCAAAGCTGAACGGGAACCATCAAAAATAGAACCCAGGTCCTCTGTCCCCCT

CAAAATCAGCACTACCATCACTCAGCAGCCAGCTGGACTCTACCCCACCTTGGGCCCCCAACCCCACTTCCCTCAGCCTGGATGCTGCTGCTGGGGTTGG

GGAAGACTGTGCTGGTACCCCCCTGGGAACCCCGAAGTCTAAATTCTGGCCATCCCCACCCCCACAAAGGAAACTCTGCTTAGTAGTTTGTCTACCTTGG

ATCGTACACAATGCAAACAGAACAGCCTGCTAGCAAGACAACTCTCCTATGACTGTACACAACCAAATATAGTGGTGTCACCTTGACCAGGAACATTTCG

AGCCATAGCCTAAGGTCAGAGTCAATGGCCATGGTGCCATAAGACTGCACACTAGGCTGGGGAACTCCCATTCTACTGGCCTAGATTCTCGTACCCCAAA

GTAGTCTGACTCTGGCTAGCCAACATCCTGCTGTCTATGCCTCTTGTAAACCCAGGACTCAGCTGAGAGAATGGCTCCCAAGAGTCTGTGGGGGTGAGTG

TATGGGCCTGGGCAGGGCCAGGCTATGGGTGTATGTAAGTGGCTGGCATCAGAGTAGGTCTTCCTCTCTATAAACATCCAGAGGTATGAATCAGGAGCGA

GGGCAAGTTGCCTCCTCTATTCCTGGAGTCTCATGTGTTACTGTCTATCCAACAATGCTCACTGAGCTCTGTTCTCTGTCTGCAGCACAGGTACCAAAGA

GGGGTGCAATGGAGGGCTAGCTCTGACAAGGGGTCTTGACTGAGATCTCACTGCTCATTATCCTATCTCAAGACTCTCAGCTTTCATCTACCACTGGTGA

CTATAATACAGACCCTTTAGTAGGTGATAGAGGCTACAGATGACTGACAACCCCAAGACCAAAGCTGTAAGCTTCCATCCTGCTAGAAAGGCTGTATTCA

GGAGGCCCTGGGAGGAGCCTCCTGGGCAGTGGATGGGAGGCTAGAGAATTTGCTGAATAGACATTAAGAAGACTCCTTCCCTGGGCAAAGTCCCTCAAGC

AGCTAGGTTGGGCAGTGAGCAGAGAAGGCTGCTGGAACTTGCAGGGGAGGGCCTAGTCCTCATCCCAAGGTCTGGAAAGGGCCTGATCCACAAAAAGGGA

CATTTCACATGCATGTGCAGACAGGACAGTGCTCAACTGGGAAAAGATACTCAGATAAGGGTCGGGCAATGAGCTCTGCCCACCTCTTTCCATGCAGATA

GAGACTCCAAGTCCTGGACCCCCTGCTGGGCTCCCCAGAAAGCCCTTCTAGATCTGGCCCCACCCTTAAACTCAGATTTGAATCTGCTGACCTCAGAGCC

TCCGTGCATTCCCAGGCCACCTGAGGAAATCCATCTTCCACGCCCACCTGGTGCAAAGGGCTTCTCTCTTGTCTCTCTGTCAGGTGCTGAGATGAACATG

ATAAGGTTTGCAGAGTTCGCAACCCAGAAGGACGGAGAAGGGCAACTTTCTTGTGGGGTTTCTAGGCAGCCCCAGCCAGAATGACAGCATCCTGCCTGGG

TGGTGTAGAATGTCCATTAAATGTATCCAATGCCT
Translation
 - UNI37028 - MLQPEGLYALEEGTALTASRNDCIICYSAYDLSVHLPRRLYCGHTFCQACMQRLDMPAHEQHWIPCPQCRQSTPVPRGGVTMLDLD

LAAFLAVKAEREPSKIEPRSSVPLKISTTITQQPAGLYPTLGPQPHFPQPGCCCWGWGRLCWYPPGNPEV

For any suggestions or comments, please send an email to unitrap@crg.es