Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075507 (AC161608.5)
Chromosomal location
Chr 14: 78913160 - 78936587 (-)
Description
not available
Human Ortholog
ENSG00000023516 (AKAP11)
Omim not available
UniTrap UNI23612
Vector Insertion
Chr 14: 78922510 - 78936518
Public Clones not available
Private Clones OST251724 (lexicon) OST110703 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7278
Vector Insertion
Chr 14: 78914879 - 78916129
Public Clones RRT325 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095623
Sequence
GCGCCACCGGGCGTTGCGGGCCGTGACGGGAGGCTGACATGCCCGGGAGCTGAGAGGCTGTGCCGCCTG - UNI23612 - GTGTTGTGTGGATTTAC

TCTCCAGCTACATTACACACTGCAGTAATACAGTTATGGCGGCTTTCCAGCCCCTCAGGAGTAGTCACCTAAAGAGCAAAGCGTCTGTCCGAAAA AGCT

TCAGTGAAGATGTGTTCCGGTCTGTAAAGTCTTTATTACAGAGCGAGAAGGAGCTATGCAGTGTATCAGGAGGAGAGTGTTTAAACCAGGATGAGCACCC

CCAGTTAACTGAG GTCACGTTTCTGGGCTTTAATGAAGAAACAGATGCTGCTCATATACAG GATCTAGCTGCAGTTTCATTGGAACTTCCAGATCTTC

TGAATTCGCTCCATTTTTGCAGTCTAAGTGAAAATGAAATCATTTGTATGAAGGATACCAGTAAATCGTCCAATGTAAGCAGTAGTCCTCTAAATCAG -

 UNI7278 - AGTCATCATTCGGGAATGCTTTGTGTCATGAGAGTGTCACCTACATTACCGGGACTCAGAATTGATTTTATCTTTAGTCTCCTAAGTAA

ATATGCTGCTGGCATAAGACACACCCTGGACATGCACGCGCATCCGCAGCACCACCTTGAGACCACTGATGAAGATGATGATGATACCAACCAGTCTGTG

TCTTCCATAGAGGATGACTTTGTCACTGCTTTTGAGCAGTTAGAGGAGGAAGAAAATGCAAAGCTATATAATGATG AAATAAATATTGCTACACTAAGG

AGCCGGTGTGATGCTGCTTCTCAGACTACTTCAGGCCACCATTTAGAAAGCCATGATTTAAAAGTGCTGGTTAGTTATGGATCACCGAAGTCACTGGCTA

AGCCCTCACCTTCAGTAAATGTACTGGGACGCAAGGAAGCTGCTTCTGTGAAAACATCTGTTACAACATCGGTTTCAGAGCCCTGGACCCAGAGGAGTCT

CTACAGGTGCCCCAGTGCCTCCGATAAAGACAAGGACACACAGGAGACATTCTTTCCTTCTCCTGTCTACTCCTCAGAGTCTGAGTGCTCAAGCCCAAGT

CCTGTGATTTTTTTGGATGAAGAGGGATATCAAAAAAGTTTAAAAGCGAAACTTGAGCTGCCTGAAATTCCTGTGACAAAAGATGATGTAGAAGATTCAG

ACTCAGAAGTGAGTGAATTTTTTGATAGCTTTGATCAGTTTGATGAACTAGAGCAAACTTTGGAGACTTACTTGCTCATGGAAGATCCTATCATAGGGAA

GTCATCACAGAAGATAGGGCACAAATATGAAAAATCTTGTATGAATCCTCAGAAATTCAAGTTTGAGCGTCCAGCTCTTCCAGCTAATGTTAGAAAGCCA

ACTCCTCGCAAACCTGAGTCTCCGTATGGTCACCTGTCTGATGCTCCAGATTCCCCTCGTCCGGTGATGACATCAGAGGATAGTGGCTTGTTCAGCCCTA

TTCGAACCTCAGCTTTTAGTCCTCCTGGAAGCTGTACTCCTGCTGAATGGTTTTGCCAAACAGATACTAGTGAAAATAGGAATCATGAAAATTACTGCAC

TTATGAGGATTATGCAAATAATCTTTCGTGTGAAGTACTAGGCTCAGTTCTTCATACTCAACATGCAAACACAATGTCAGATATTAATAGTATTAAAAGG

GGAAGAAATCATACGGTAACTTTTAAGTATGGAGACTCTGATCAA
Translation
 - UNI23612 - MAAFQPLRSSHLKSKASVRK SFSEDVFRSVKSLLQSEKELCSVSGGECLNQDEHPQLTE VTFLGFNEETDAAHIQ DLAAVSLE

LPDLLNSLHFCSLSENEIICMKDTSKSSNVSSSPLNQ - UNI7278 - SHHSGMLCVMRVSPTLPGLRIDFIFSLLSKYAAGIRHTLDMHAHPQHHLE

TTDEDDDDTNQSVSSIEDDFVTAFEQLEEEENAKLYNDE EINIATLRSRCDAASQTTSGHHLESHDLKVLVSYGSPKSLAKPSPSVNVLGRKEAASVKT

SVTTSVSEPWTQRSLYRCPSASDKDKDTQETFFPSPVYSSESECSSPSPVIFLDEEGYQKSLKAKLELPEIPVTKDDVEDSDSEVSEFFDSFDQFDELEQ

TLETYLLMEDPIIGKSSQKIGHKYEKSCMNPQKFKFERPALPANVRKPTPRKPESPYGHLSDAPDSPRPVMTSEDSGLFSPIRTSAFSPPGSCTPAEWFC

QTDTSENRNHENYCTYEDYANNLSCEVLGSVLHTQHANTMSDINSIKRGRNHTVTFKYGDSDQ

For any suggestions or comments, please send an email to unitrap@crg.es