Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075520 (OTTMUSG00000011393)
Chromosomal location
Chr 2: 15963753 - 16072432 (+)
Description
predicted gene, OTTMUSG00000011393 Gene [Source:MGI Symbol;Acc:MGI:3651283]
Human Ortholog
not available
Omim not available
UniTrap UNI36158
Vector Insertion
Chr 2: 16063944 - 16072376
Public Clones IST11916E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100388
Sequence
TACACAAGCACCGCAGGAAGCTGCAATTTTGAAACAACTTCAGGAGACTGGACTGTGGAGTGTGGACTCACCCAAGATCCTGAAGATGACTTGGATTGGA

GCATCGGTAGCATAATTCCTACTGAAGGCTTGAGCAGAGATTCGGACCACACACCAG GTAGTGGACGGCATTTCTTGTATGTCAACACTTCTCTAGCTG

AAGAAGGATCTACTGCAAGAATCATTACCTCTCACTTTTTTCCAGCAAGCCTTGGAATATGTACTGTTCGGTTCTGGTTCTACATGGTAGATCCCCATAT

TGTGGGGATATTAAAG GTATATCTCATCGAGAAATCAGGACTAAACATCCTGATGTGGTCCATGATGCGAAACAAAAACACTGGTTGGACCTATGCGCA

TGTACCTCTTTCTAGTAACAGTCCCTTCAAGGTTGCATTCGAGGCTGACTTGGGTGGAAAGGAGGACATCTTTATTGCTCTTGATGACATCACTTTCACA

CCAACGTGTGCATCTGGAG GACCAGCCTTACCACAGCCACCACTTTGTGAAGAAGGCCAGTTTGCTTGTATCTACGCACTCCAGTGTGTCTCTGCTTCA

GAGAAGTGTGATGGGCAAGAAGATTGTATAGATGGATCTGATGAAATGAATTGCTCTCTCGGACCCTCTCCTCAACCATGCAGTGATACAGAATTCCAGT

GCTTTGAAAGCCAGTGTATCCCATCTCTCCTGCTATGTGATGGAGTGGCTGATTGCCAATTTAATGAAGATGAATCCAGCTGTG TCAATCAGAGCTGCC

CCAGTGGAGCTTTGGCATGCAACTCATCGGGCCTCTGTATCCCAGCTCACCAGCGCTGTGATGGTACTGCCCACTGCAAGGACATTCAAGTAGATGAATC

CAGCTGCTCAG - UNI36158 - AGTGTCCAATACATTATTGCAGAAATGGTGGCACTTGTGTGATAGAGAATATTGGT
Translation
YTSTAGSCNFETTSGDWTVECGLTQDPEDDLDWSIGSIIPTEGLSRDSDHTPG GSGRHFLYVNTSLAEEGSTARIITSHFFPASLGICTVRFWFYMVDP

HIVGILK VYLIEKSGLNILMWSMMRNKNTGWTYAHVPLSSNSPFKVAFEADLGGKEDIFIALDDITFTPTCASGG GPALPQPPLCEEGQFACIYALQC

VSASEKCDGQEDCIDGSDEMNCSLGPSPQPCSDTEFQCFESQCIPSLLLCDGVADCQFNEDESSCV VNQSCPSGALACNSSGLCIPAHQRCDGTAHCKD

IQVDESSCSE - UNI36158 - ECPIHYCRNGGTCVIENIG

For any suggestions or comments, please send an email to unitrap@crg.es