Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075595 (Zfp652)
Chromosomal location
Chr 11: 95573987 - 95633667 (+)
Description
zinc finger protein 652 Gene [Source:MGI (curated);Acc:Zfp652-001]
RefSeq_dna
NM_201609 
RefSeq_peptide
NP_963903.2 
UniGene
Mm.418731 Mm.458344 
MGI
MGI:2442221 
Uniprot/SWISSPROT
Q5DU09 
Uniprot/SPTREMBL
A2A616 A2A617 
Human Ortholog
ENSG00000198740 (ZNF652)
Omim not available
UniTrap UNI25831
Vector Insertion
Chr 11: 95574048 - 95610313
Public Clones IST12999B5 (tigm) IST11010E2 (tigm) IST14539H5 (tigm)
Private Clones OST160117 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11784
Vector Insertion
Chr 11: 95614337 - 95614675
Public Clones A026E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12124
Vector Insertion
Chr 11: 95615370 - 95624852
Public Clones A055B01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091565
Sequence
AGAACAGCCCTTTTTGACTTAAGGTGGCGGTGGTGCTGTGACACAGGAAGAACTGCATGCAGGCTGCAGGAGTTTCTTATTCTCACTTCTTGAGTAGTTA

GTTCTCCGTGGAGGGAGAAAGATTTGAGTCTTAATTGCCCTGTTTTCAAGGTGTTCTGTGTCGTCTGAACTGGGCCACTTCCTAATGAGCTACACAGCCA

GTCCTTGTCCGGAGCTGGTTGAACCCTGTGCAGTGCATGCAGAAGGAATGGCCCAGGAAGAGAGCCATCGAAGTCAGGCGCCACCCACCTTCTACCATGG

TGCCAGCCAGGAGCTCGACCTGTCCACCAAAGTGTATAAAAGGGAGTCTGGAAGCCCTTACTCTGTGCTAGCAGACACCAAGATGAGCAAACCACATCTC

CACGAGACGGAGGAGCAGCCATATTTCAGGGAGCCAAGGGCAGTGTCTGATGTGCATACTGTCAAGGAAGACCGGGAGAATTCTGATGACACGGAAGAGG

AGGAGGAAGTCTCTTACAAAAGGGAGCAGATCATAGTGGAGGTAAACCTTAATAACCAAACATTAAATGTCTCTAAAGGGGAAAAGGGTGTCTCTTCCCA

GTCCAAAGAGACGCCTGTCCTTAAGACAAGCAGTGAGGAAGACGAGGAAGAGACTGAGGAGGAGGCCACAGATAACAGCAGTGACTACGGAGAGAACGGA

CGGCAGAAGAAAAAGGAGAAGCAAGTGGAGAGAGTCAGGGTTACACAGAGGCGAACCCGGAGAGCGGCCTCTGCTGCCGCAGCTACCACTTCCCCTGCAC

CCCGCACAACTCGAGGCCGTAGGAAAAGTGCAGAGCTACCCAAGAGGAAGAAGCGGGCCACCAAGGAGGCTAAAGCGCCAGTTCAGAAAGCTAAGTGTGA

AGAGAAAGAGACTCTGACCTGTGAGAAGTGCCCCAGGGTGTTTAATACTCGCTGGTACCTGGAGAAGCACATGAACGTTACTCACAGGCGCATGCAGATC

TGTGATAAATGTGGCAAGAAGTTTGTCCTGGAAAGTGAGCTGTCCCTTCACCAGCAAACAGACTGTGAAAAAAACATTCAG TGTGTTTCCTGTAACAAA

TCCTTCAAGAAACTCTGGTCCCTTCATGAACATATCAAGATTGTCCATGGATATGCAGAAAAAAAATTTGCCTGTGAAATTTGCGAGAAGAAGTTCTATA

CCATGGCTCATGTACGAAAACACATGGTTG - UNI11784 - CACACACAAAAGACATGCCATTTACATGTGAGACCTGTGGAAAGTCTTTCAAGCGC

AGTATGTCACTCAAGGTGCACTCCTTGCAGCATTCTGGAGAGAAACCCTTCAGATGTGAG AACTGCGATGAGAGGTTCCAGTACAAGTACCAGCTCCGC

TCCCACATGAGCATCCACATTGGGCACAAGCAGTTCATGTGCCAGTGGTGTGGCAAGGACTTCAACATGAAGCAGTACTTCGACGAGCACATGAAGACGC

ACACTG - UNI12124 - GAGAGAAGCCTTTCATCTGTGAAATCTGCGGCAAAAGCTTCACCAGCCGACCCAACATGAAGAGGCACCGCAGAACTCAC

ACAGGCGAGAAGCCCTACCCCTGCGATGTGTGCGGTCAGCGGTTCCGCTTTTCCAACATGCTGAAGGCCCACAAGGAGAAGTGCTTCCGAGTGACCAGCC

CAGTGAATGTGCCGCCAGCTGTCCAGATCCCACTGGCCTCAGCTCCAGCTGCTCCCGCTCCGGCCGTGGCCAACACTCCCACCAGCCCAGCCCCTGCAGT

CAGTATGAGCCCCGTGGGTGCTGTGCTTCCCTCGAGACCCGTCCCGCACCCTTTCTCACACCTGCACATACACACGCATCCACACCACGCGCACCACCTC

CCCATCCCTCCTGTGCCTCACCTGCCCCCACCCCCAGCCCTCTTCAAGAGTGAACCCCTAAACCACAGAAGCCAGAGCGAGGACACCTTTCTGAGACACC

TGGCAGAGAAGAACAGTGCGGCCCCCGCCCAGCACCATTAGCCCTAGCCAGTGCCGTCCCCACGGTGAGCTGGCAGAAGGGACGCAGCCGTACTTCTCTG

GGGTCTGCCTGACTCCACGGCCTCCTTCAGGGCCTTCACCGTTGTCCTGGTGAGCCCTCAGACTGGCCTGACGGAGTGAAGACGACGACTGCCCTTGAAA

CCAGGGGAACCACCGAACTAAAGCCCAATTTGCTTGCATTTTCTGATGACTTTTATAAATTTCAGATACTGTGACTGTGGGATTTTATAATTTCATATCA

GCGGATGAGGTATGCTTGCTTTTATATCTCGGTCTTCTCCTCAGAGAGGGGTGGGCCTGTTTCCTTTATACTGATCGGGAAGGCTGTGAGGTTAGTCCAG

AGCATTAACTATATCACTGTGTACTGCAATGAATTCGGTTCAGCTTTTGGTGCTGGCTGCAGAGTCGAGCTGGCTGCGTTTCACACAATATCAAGCATTA

TAGAGAAGATGGGAATTTTCTTCTTTGTGTAGCTCTTTTAACACACTCTTTATTTTACTACAGAAATTATTTTAGAGTTTTTGTATAGACTTTAGTAGTC

TGTTTCTAAAATGAGATGTATTTCAATAAGCTGTGTAATTTTTTCAGTGTAGCTAAACCCATGTTGTAAAATAGATAAATTTTTATAATCATC
Translation
MSYTASPCPELVEPCAVHAEGMAQEESHRSQAPPTFYHGASQELDLSTKVYKRESGSPYSVLADTKMSKPHLHETEEQPYFREPRAVSDVHTVKEDRENS

DDTEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEDEEETEEEATDNSSDYGENGRQKKKEKQVERVRVTQRRTRRAASAAAA

TTSPAPRTTRGRRKSAELPKRKKRATKEAKAPVQKAKCEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKNIQ 

CVSCNKSFKKLWSLHEHIKIVHGYAEKKFACEICEKKFYTMAHVRKHMVA - UNI11784 - AHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPF

RCE NCDERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTG - UNI12124 - GEKPFICEICGKSFTSRPNMKRHRRTHTGEKPY

PCDVCGQRFRFSNMLKAHKEKCFRVTSPVNVPPAVQIPLASAPAAPAPAVANTPTSPAPAVSMSPVGAVLPSRPVPHPFSHLHIHTHPHHAHHLPIPPVP

HLPPPPALFKSEPLNHRSQSEDTFLRHLAEKNSAAPAQHH
Transcript ENSMUST00000107717
Sequence
GCAGGCAGCCGGCGGTTATCTGCTCGGCTGAGCGCTCACATTGTGGCAGGAGGGAGAAAAG - UNI25831 - ACAAGATGCTCCAAGTCCCCTGCAG

TTCTCTTCGAAAGAAGACGAGGAGTGCTCTGCGCCTGCCGTAAGAACAGCCCTTTTTGACTTAAGGTGGCGGTGGTGCTGTGACACAGGAAGAACTGCAT

GCAGGCTGCAGGAGTTTCTTATTCTCACTTCTTGAGTAGTTAGTTCTCCGTGGAGGGAGAAAGATTTGAGTCTTAATTGCCCTGTTTTCAAGGTGTTCTG

TGTCGTCTGAACTGGGCCACTTCCTAATGAGCTACACAGCCAGTCCTTGTCCGGAGCTGGTTGAACCCTGTGCAGTGCATGCAGAAGGAATGGCCCAGGA

AGAGAGCCATCGAAGTCAGGCGCCACCCACCTTCTACCATGGTGCCAGCCAGGAGCTCGACCTGTCCACCAAAGTGTATAAAAGGGAGTCTGGAAGCCCT

TACTCTGTGCTAGCAGACACCAAGATGAGCAAACCACATCTCCACGAGACGGAGGAGCAGCCATATTTCAGGGAGCCAAGGGCAGTGTCTGATGTGCATA

CTGTCAAGGAAGACCGGGAGAATTCTGATGACACGGAAGAGGAGGAGGAAGTCTCTTACAAAAGGGAGCAGATCATAGTGGAGGTAAACCTTAATAACCA

AACATTAAATGTCTCTAAAGGGGAAAAGGGTGTCTCTTCCCAGTCCAAAGAGACGCCTGTCCTTAAGACAAGCAGTGAGGAAGACGAGGAAGAGACTGAG

GAGGAGGCCACAGATAACAGCAGTGACTACGGAGAGAACGGACGGCAGAAGAAAAAGGAGAAGCAAGTGGAGAGAGTCAGGGTTACACAGAGGCGAACCC

GGAGAGCGGCCTCTGCTGCCGCAGCTACCACTTCCCCTGCACCCCGCACAACTCGAGGCCGTAGGAAAAGTGCAGAGCTACCCAAGAGGAAGAAGCGGGC

CACCAAGGAGGCTAAAGCGCCAGTTCAGAAAGCTAAGTGTGAAGAGAAAGAGACTCTGACCTGTGAGAAGTGCCCCAGGGTGTTTAATACTCGCTGGTAC

CTGGAGAAGCACATGAACGTTACTCACAGGCGCATGCAGATCTGTGATAAATGTGGCAAGAAGTTTGTCCTGGAAAGTGAGCTGTCCCTTCACCAGCAAA

CAGACTGTGAAAAAAACATTCAG TGTGTTTCCTGTAACAAATCCTTCAAGAAACTCTGGTCCCTTCATGAACATATCAAGATTGTCCATGGATATGCAG

AAAAAAAATTTGCCTGTGAAATTTGCGAGAAGAAGTTCTATACCATGGCTCATGTACGAAAACACATGGTTG - UNI11784 - CACACACAAAAGAC

ATGCCATTTACATGTGAGACCTGTGGAAAGTCTTTCAAGCGCAGTATGTCACTCAAGGTGCACTCCTTGCAGCATTCTGGAGAGAAACCCTTCAGATGTG

AG AACTGCGATGAGAGGTTCCAGTACAAGTACCAGCTCCGCTCCCACATGAGCATCCACATTGGGCACAAGCAGTTCATGTGCCAGTGGTGTGGCAAGG

ACTTCAACATGAAGCAGTACTTCGACGAGCACATGAAGACGCACACTG - UNI12124 - GAGAGAAGCCTTTCATCTGTGAAATCTGCGGCAAAAGC

TTCACCAGCCGACCCAACATGAAGAGGCACCGCAGAACTCACACAGGCGAGAAGCCCTACCCCTGCGATGTGTGCGGTCAGCGGTTCCGCTTTTCCAACA

TGCTGAAGGCCCACAAGGAGAAGTGCTTCCGAGTGACCAGCCCAGTGAATGTGCCGCCAGCTGTCCAGATCCCACTGGCCTCAGCTCCAGCTGCTCCCGC

TCCGGCCGTGGCCAACACTCCCACCAGCCCAGCCCCTGCAGTCAGTATGAGCCCCGTGGGTGCTGTGCTTCCCTCGAGACCCGTCCCGCACCCTTTCTCA

CACCTGCACATACACACGCATCCACACCACGCGCACCACCTCCCCATCCCTCCTGTGCCTCACCTGCCCCCACCCCCAGCCCTCTTCAAGAGTGAACCCC

TAAACCACAGAAGCCAGAGCGAGGACACCTTTCTGAGACACCTGGCAGAGAAGAACAGTGCGGCCCCCGCCCAGCACCATTAGCCCTAGCCAGTGCCGTC

CCCACGGTGAGCTGGCAGAAGGGACGCAGCCGTACTTCTCTGGGGTCTGCCTGACTCCACGGCCTCCTTCAGGGCCTTCACCGTTGTCCTGGTGAGCCCT

CAGACTGGCCTGACGGAGTGAAGACGACGACTGCCCTTGAAACCAGGGGAACCACCGAACTAAAGCCCAATTTGCTTGCATTTTCTGATGACTTTTATAA

ATTTCAGATACTGTGACTGTGGGATTTTATAATTTCATATCAGCGGATGAGGTATGCTTGCTTTTATATCTCGGTCTTCTCCTCAGAGAGGGGTGGGCCT

GTTTCCTTTATACTGATCGGGAAGGCTGTGAGGTTAGTCCAGAGCATTAACTATATCACTGTGTACTGCAATGAATTCGGTTCAGCTTTTGGTGCTGGCT

GCAGAGTCGAGCTGGCTGCGTTTCACACAATATCAAGCATTATAGAGAAGATGGGAATTTTCTTCTTTGTGTAGCTCTTTTAACACACTCTTTATTTTAC

TACAGAAATTATTTTAGAGTTTTTGTATAGACTTTAGTAGTCTGTTTCTAAAATGAGATGTATTTCAATAAGCTGTGTAATTTTTTCAGTGTAGCTAAAC

CCATGTTGTAAAATAGATAAATTTTTATAATCATCAAAATGTGATTCTCAAAGATGCATATAATAACTTCTATCTCAACTATTCTTACATCCATACAACT

CAAAGGTGCTTCTGTGACTGGATGTATCTGAGCGGGTCACCAGACCAGGTACAAAAGCAAGGTTCAGTACAAAGTTAGTCAATGAATTGGATGTCTCTGC

TGGGCATTCAGTCCATTGGGCTCACTGACACAGCCAGTGTTGGTGTCCCTTTGAGTACTCTATGGATTCAGTGGGGTGGTGTGAGGGAATGGGGTCACTC

AGAGTTAGCGGGGCTTGCAAATGTGAATGACATTTGTGAATGCCCTCGGGAGAAAGTGACGGAGGTCGTTTCCTTGGATCACGTCTGTTTCTCACTTTCT

TAGAAACTGTGTTGTGCGCAGCTGTTAGGGGAAGATGGATTGGAATCTCTTACTTTGAGGCTCCTGTGTTTTCCAAGAGTGTTAGAAGAAGCTAATAGGG

TGAACTGAAATCACAAACGTAATTGCTGGTAGTGACCAAGAAATGTGGATGGGAAGGCAAGTTGACTTTTAAGTTTTAAGATGCCTGCAGTCTCTAAAAC

GTGGATGTCCACACTGACTGGTATCTGCCATTAAAAATGTAGTGAGAGGAAACCCCCAATACTGTTGCCTGCCCTCTCCAGAGGAGGGAGACCGCAGCAT

CTTAGGTGAGGAAGGAACAGTGCCCTTGTCTCTCGAGCGGCAGCTTACTCGGTCAACATTTGGGGAACTTAAACAGAGCGTGGTCACCCTGGAGTGGATA

TACGGAAGGCCAGAGAGAAGGGCTAACATGGTGGTTTCAGTCAGCTGACAGGTGTGCACGGCACAGCTCCTACGCATTCTGTGCTGCTCTTCTCAGAGGC

TGAGTTCCAAGAATGGCCTCTGCCTCCCACCTCTCTCCTCCTCGTCTCTCTATCCTCAGGCTCTTAAATCAGACCCTTAGCTGTTATTTATTTATCTTTG

ATATTAAATGTGCAGTTATGCGTTGTGCACTTTTTCCTGGCTACTTAACTCTGCAGTGGGGACACACGGACTCTGGACTGAGGTTAGGTTCCTGCTTTTA

AAGTATCATACTCTAAATTAGTTTTTTTGGTTTACTATTTCTAGATTTTTCTCCAGTTTTGCCCTTGTCTTCTGTAAACATAGGAAACATTGTGTGTGGA

GTCAGGAAAGTCTCTCAGGACACACTTTCCCTCCAGCTTCTAGCTATGAATTTTAATGAATGGTATTTGTAATATTTGCATGCATTCTTGCAGCCCTCAC

AAACCCGAGGCAAACAAGGAAGCAGGTTCCTTTTCTGAATGTCGTGACTTAGAAGTCACCCCTACCCCATTTACCTCCACAGTCTCCTCTGCAGCTTATG

GGAAGTCTGCAAATCCACCTTCCATGTAGACAGATCCATATCTCACGGCTAAACCTATAATATTCAAGTATTTTTATCAAAAAAGGTATAATTTGTAGCT

AAGTTAATAATTGGTTATACCTTATTTTATACTAAATGCTTTTACAATATGAGGCAGACATTCTGAATTCTAGTCTTGAGGCTGTTGAATTACAACCATT

TGATGGTTATACTATGAATATTCATTGAAAAATTCAGGTTGTCAGTTCTGACTTTATTCAAATGACTATAGCCATAAGAAACTGTCCTCTACATAGGAAA

CCCAATAGCGAGTCAGTAAGCATCACTATCCTTAACAGAAGCAGAAAAAAGAATTTAAAATAGTGACTTAGGCCTACCACACTCTGTCATTCTTACTCAA

ATGTGAAACAGTGTAGAAATGGCAATATATTTTTTTTTTCTAGAGAAGTTTATCTTCCCTGACTTGAGAAGCCTGCTCTAAAAAATGGCTCTCAAAAGTG

TACGACTAATGGGCATATGTATAATGAGATCTATACAGAAATGCTTCGGAGTCAGAAACCACAGGGTCACGCCTTAAACATGCAGGTACCTCAGCTGTCA

CGTGCTGAAGACTCAGACTCAGGGTTGACAGTGTACTTGGGGAAGAGCTGCAGTGTGTGCTGTGCTGGCCCACATGTGCTGCAGCGCCCCAGGAGTTCTA

CAGTACCTGTTACATTCTTGTTACCTGTCCATGGAAAAAGACCCGTGGAAGAGTTGGAGTTCTAGGCTTGTATCTTTACTGTTGTCTCGTAACACGTTAC

ATTTCAGAATAACAGATTTTAAGTCAAGGCTTTCTCTTTACACCATTCTATCTTCAAAGGCTTTGTTGTGGCAAGGATTACTTAGTTACAAGTAGACCAG

GCTAGCCTTGAATTCACAGCCTGAGTGCTGGGTCTACAGGAGGGAACCACAACCGGCCCCTCCCCCAAGAGTTTTGTTGTTGTTGGGGTTCTTGTTTTGC

TTTTTTTGAGAAAGGGTCTCTCACTAAATACCTACGCTAAGCTGAACTCCCCAGTGGATACGGTCATGGTTACCTCAAACCCATGACTCCCTCACCTCAG

CTTCCCAAATGCTGGGCTCGTTGTACCTGCTCCCCCCGCCTGGCTTCCACAGCGATGTTTCTGTGTTGGTATTACGTTGTTTTGGGTTGAGTCATGCATC

ACTTGCTTTCTTCTCATGGATTTATCATTTGGATACAAACTTTTTTAGCCTAATTCATTAGGCTAATTCATTAGGCTGCTGCTCTCAAACTGAGTCAGGC

TCAGACTGGGTTAGGTTTTAAAACTGAAGGAAAAGAAGATTTAAAGGCACGTGGCTTCATTTTATTTTATTTGTATATTATTTTGACTTGATTCTTATTT

TTAGCAAATGGAGAAGTCTCCACATAAAACTTTAATAAAGTTTAAAGAAACCTTTGTAAATCATTGCCAGGTACTGTCTTAGTAACCCTCAGCCTTAGGC

CTCACCACGGGCCTTTCCAGAGTTGTCCAGTCTGAGAACCTCATCTGTTGACAGTATCCTTCTGAGCTAGCCCCCACCCCATACAGCCCACCCCACAACC

TCACCCCGTCTAACCAGAGGCAAAAATCTTTGAAGTTTGGAATTTTTAACTTCTTGAAAATCTTTTTCAGTTTTATGATTGTTGAGTGGATGTGGATGTG

TGTTTAGTTTCATTTTTATTTCCCTAGAAGATTTAAATTTTGAGACTATGAAGCAGAGAAAGAACTCCACTGCGGAGGCGTGTGTGTGTGTGTGTGTGTG

TGTGTGTGTACACATGTGCACATACTCATGAATGCACACATCTATATGGATCTAGTCCCTCTTGGAGGTTTGGTTAGGAAAACACACTAGAGTAGGTGAG

CTTTTTGTATTTAAAGAGAGAAAAACTAAAACTTCCATTAAAAGAACCCCTCTGTTTAAGTCAAAGGCGCCCCCTTTGTTTAAGCTACTGTATGAAAAAT

ACCACTTTTGTTACTTTGATGGTCCACATGCTAGAGATTTTGATGCTGTTCCGCATGTGTAGCATGCCATGAGAAGAGAGAGTATGTTAGAGCTAACCAT

TTTATCAACTAAAAAAAAATCAGCTGGGATTCTTAAACTTCTAACCCTGAGCAAAGAGTCACCAGGTTTAAGGTTTTTCTCTACTTAAAACCAAGGTAGA

AAATTCCCAGGAGTTCTCGCTCTCTCCATTTTTTTTTTTTCTTTTTCAGGAATAAAGGGTCATAAGCCATTAGAAACAGTGGCATTGTTATGCAATAACA

GCTCACTAGCTAACCTACAGTCTTGGGAAGCAATGCTGACCTTCCAACCCGGAACTACCTCGCTAAAGCAGCCCAGAGGTCCCCACTGCACTCTCTGTGG

AAGCCATAAAAGTCGCCAGTGTGTCCGTTCACCTTCACAGCTGAATACTTTTGTACCCGCTAGGCCTGTTTATAGACTTATAATCAGACCTTTCCCTCTT

AGGGGACAGCTTTTCCAAGACTCCAAGGAAAGTCAGATTCCTCTGAGAATTTTCCTCAAGTTGCTTCAAAGAGCAACTTTGTAGCTCTCCAGCTTCAGTA

AATTTGTTTAAAGAACCAGATGCCATATCATTCAAAAACATTACGTTTAATTCAAAACTACTGTGCAGACCTACATATTCTGAAAACAAACTCTTCCTTT

TTGTTCCCTTAGTAGAGGCTGTGTTGTTATAAAGTGGGTCTCTCTCCACCCTGTTAACTCAGGGCTTCTGGTTGATGTGTCGGGACAGCGTCCCTGGAGT

TGTTTCTGTTACTGTAGCACAGAGACCTGAGTACCTGGCCGTCTGATCTCCTACTGTCTACGCAGCTTTACTCTCATCACTCTGCTCTCGAGTGCCTTCA

AAAAAGCCCATGTCCTGGAGCCTCTGTCCCGGTCTGAATCCTACCTCTGATTGAGTCGTTCTCCTGAGCATCGGAATTCACCCTCTTCCCAAGGGCTTAA

CTACAAACTCTAACACCTGGCTAGGAATTGTGAACACAGTTGTGTATTGTTGCCCTGTCATTCACGGCAGGGTCACCTTTGTAGCTTCTTTGTATCTTAT

TCCCCCACCCACACCACTTCTGGACTAGAGCCATTTGTCCTTCACCTTCTAGTCTTTCACCACAGACCGACGGTTCCCTTAAAAATCAAAGGTCACCCAG

TGCATCTCTGGGTCATCTTTTTCTCATCTGATGAAGTCTTCCTGAGTACCTACCCTTCAAACTAAAGGAGCGCGAGCTGCCGCTGGGGCGCACATAGCAT

CGCGTAACACTTGGTTCTTCCAGTGGCTAGCCTAGTCATAGGAGGAGAAAAGTGCTCTCTGGGGTTAACAAATTCCTTTCTTGATTTTTGATCAGCCCCT

CTCTCTCATCAGCCACCTGTCCCCCTTGTAAGCCCCATTACGTCATTTACAAAGTGTGATTGATGTCTAATGTATGAAAGACGGAGGAAAAAGGAAGCTG

ATGTGTGCTCTGTGTGTAGTATGTGCACTTCACTGTAAAGATTACTTTAGCAACTGGCTGGTCTCTCGTGTCCCAAATTAAAGTTTGTGCTGTGTAATGG

GTTGATAGTTCCCTCCTAAAGCAAAAACAGATGAGCTCTTTCGGTGAGGAAACAGGATTTTTTTTTTTTTTTTTTTTTAGGCAAATGAACACTAATTAGA

GTATCCTGACCTGAGTCAAAAGCTTTGCTTTCTGACTTACAGTCTCTTGCATCTTTCCTTCCAGTTATTAGTACCCAGGCACCCAAGACTGATTGATGGT

CGCACACCGTGGGAGACTTGAAAGGCGGCTGTTGATAAATTTTTCATCCTTTTTTTTGTCTGTGAACAGACAGGATGCCAGTGGGTGGGACAATACCAAA

TTGTGAGAATTGGGTTGAAAATACAGAAGTCAAGACATTGGAATGCCCCACTGGCTGTTTGGATTGAGAGCGGCATGCACACTGGAAGAGGTAGAGTCTG

TGGTGCAGAAATCATTCCCAAGTGTCTAAAGGACCCTCCATGTTTGCCGCTGCGGTCAGTCTTGGGAACTGGGTGCTTTGAATCGGTTCCTTTTTCTCCA

GTGTCCCGGGCGTTTGGATAGCGAAGAGCCATAGTCACCTGTCACTGGGAAGACCCATACCCTTCGAGAAGGATGGCTGCGTTATTGTGTCTGGATTAGG

ATACTTTTGGTCAAGTATCAAAGAGAGTTGTTGCCCCTCAGAGGTTTCCCCATCACTAACCCCAGCTTACCTTCATCCTATTTGAGCTTCTCTGGTGAGA

TTGGGGATATGGCAGATTACTCGAAAATGATTTTATAGGTGATGGAGATGCTCAAAAAGGGAGGGAAGCTGGGGCTTTGTTTAATGTCAAAAGGAAATCG

GATGGTTTCAGTCGAGTCAAGAGCCTGCCTGTATGGGTCTGAAAAGAGAGCAGTGGCTTGTTTCTGTGTCTCTGGCTCCCGTGAACGAGCACAGCCTCTC

CATCTGCCTTACCATGTAGGGAGCCAGGGAGCCAGAAACAGGGTCTCCATCACACCCCGAGTAGGCTCTGTGACTCTGGCTGCATTGGAAAATACACATG

ATCACTCACTTGAGTTAAGTTGGAAAGAAATAAATGGTGTAGTGTAATGTCTGTGTTTACTTCTCAAATTGTATTGCTAGATATGTGGCCTCAAAAAACC

AGGTGAATTATCTTCCAGAATATGAGGGGTTGGGAGTAGGGGTGAGGGTTGTTTTGGGTTTTTGTTTCCTCTGCAGTACTTGTTTTGGCCATACGGGGCG

ATAAAGTACTTTCTTCTTAGCTTTTAAGTCTCTTCTGGGCTACCTCTTGGCTCACTGATTGGATTTGACTAAAACATTTTCACGATCACTAAGTTGAGCA

GTTACTCAGGCCTGGTGATGTGAGCAGAGATGGGGTCCTGTGTCTGAGGTCCATGTGGCTCGTCAGGCATCATAACCAGCAAGCCTTTGTTAATATTGGT

TCCATGAAACCGAAAGCTAGCCCTTATCATAAAGGCTCCATTGTTTACTAAACGCAGAACTAAAGGTGACCCTCCTCCCTGTTTCCACCCTCCCATTGCA

GCCCAGTCTGCCCTATCACATCTGTGACAGCAGTGGGGACCTCTCATGTGTAAGCACACGCTCTCTCACTTTTTCTGCTCCAGGTGGGTAGGAAGGTCTC

CCAGAGCAGGCCTGGCCCTCTCTCTGCACAGGTTCCTTGTCTTTGGGCTCCTGGCCCTCTTCAGCTCTCGGGGAATATTGAATGCGTCCTTTGCAGTGTC

TCCAGAGGAACAGTTGGCTATCCACTCAGGAAAGCACAGGCCTGAGGCTGTTTACCTTGCAGGGTCAGGAAGCATTTTCCTGTGGAAGGGCCTCCTGCTG

ATTTTCTCCTGGTCCTTTCCCCCAGCAAGAGTCTGTGCAGTGCCAGTCGGGGGGTCCTTGTAATTCCAGCCCAGGCAGAAGTGGAAGGGAAGCAGTGACC

AGGGTAGATAGCAGGTGTCCGGGTGTCCCCACAGTCCTGAGGTCACTTGCACTTTCTCATTTCTTAAAGGAAGTCCAGTGTTCTTGCCAGGAATCCTTAG

CCTTAGGTTTACAAAGCTTGCTGTTGAATGTTCGTCCGGAGGAGTGTAAGAAGGCAGGAACTGCTTGGTTCCAGTCCTGCCTGCAAGGTCAAGAAGGTTT

AAGACTACGTCTAATCTGGAATCCTTACCTCTGTAGAGGGCGTTGAAGGTCAAGCTGGGACGGTGAGGGGTGCTGTAAAGAAGGTCATTGGGCCTTCAGT

TGTGGGTGGGGGTGAGTGGTGGGCAGGACAGAGTCTTACTAGGATGGGAAGGAGGGAGAGGAGGGCTTGGCCCAGGGAGCTGGCCGCATGGTGGGTGGAG

CCAGGTGGGCTCTGAACTGGTCCAGATGCCTGGCTTCCCTTAGCCATCTTTTCCCTAGCATCCTGTCAGACCCCCGGCGTGATGATATGCTTCCCTGTGT

TAACTCTACCAATATTATTTTTTTAGCAATGGAAATGCACTTTTTTTTAATTTCAACTCAATCATGATTTTAAGTATAAAAATTTATAGATTGTTAAAAC

TACTTTTTTGTGTATTTTTAACCACTCAATGTAGCATTGTATATTTTATTCTTATTGAGACTCTGGTACAAGGTGTGCCATTTAATGATTTTTTCCCCCC

AACATGCTGGGCCTTTGGATGTGTACGGTAACCAACTTCATGCTAATGTTCAAAGTAAAAAAAGAAAAGTAGCCATA
Translation
 - UNI25831 - MSYTASPCPELVEPCAVHAEGMAQEESHRSQAPPTFYHGASQELDLSTKVYKRESGSPYSVLADTKMSKPHLHETEEQPYFREPRA

VSDVHTVKEDRENSDDTEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEDEEETEEEATDNSSDYGENGRQKKKEKQVERVRV

TQRRTRRAASAAAATTSPAPRTTRGRRKSAELPKRKKRATKEAKAPVQKAKCEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESEL

SLHQQTDCEKNIQ CVSCNKSFKKLWSLHEHIKIVHGYAEKKFACEICEKKFYTMAHVRKHMVA - UNI11784 - AHTKDMPFTCETCGKSFKRSMS

LKVHSLQHSGEKPFRCE NCDERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTG - UNI12124 - GEKPFICEICGKSFTSRPN

MKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVTSPVNVPPAVQIPLASAPAAPAPAVANTPTSPAPAVSMSPVGAVLPSRPVPHPFSHLHIHT

HPHHAHHLPIPPVPHLPPPPALFKSEPLNHRSQSEDTFLRHLAEKNSAAPAQHH

For any suggestions or comments, please send an email to unitrap@crg.es