Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000075703 (D5Wsu178e)
Chromosomal location
Chr 5: 30559158 - 30598976 (+)
Description
Ethanolaminephosphotransferase 1 (EC 2.7.8.1)(Selenoprotein I)(SelI) [Source:UniProtKB/Swiss-Prot;Acc:Q80TA1]
RefSeq_peptide
NP_081928.2 
UniGene
Mm.168854 Mm.405348 Mm.472151 
MGI
MGI:107898 
Uniprot/SWISSPROT
Q80TA1 
Uniprot/SPTREMBL
Q8BS27 Q9D4D0 
Human Ortholog
ENSG00000138018 (AC010896.15)
Omim not available
UniTrap UNI27590
Vector Insertion
Chr 5: 30559356 - 30574008
Public Clones not available
Private Clones OST55980 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000082436
Sequence
GGTGGGCGGAGCGCGCCTCTACCTTCTTTACCAGCCCAGGCTTTCCTAGCTCTGCACAACGCCGTGTGCTGCTCCTGTTTCATTGCCCTGTCGCGCAGTG

TCGCTGCCGCTGCGGAGTGGGCGTTCAGTTTTCGGGTCGTCATGGCTGGCTACGAATACGTGAGCCCAGAGCAGCTGTCGGGCTTTGACAAGTACAAG -

 UNI27590 - TACAGCGCTTTGGATACCAACCCACTCTCTCTGTATATCATGCATCCATTTTGGAACACTATAGTGAAG AAAAAAAAACAGGTGTTT

CCTACTTGGCTGGCTCCCAATCTTATAACCTTTTCTGGCTTTATGCTGCTTGTGTTCAATTTCCTACTCCTGACATACTTCGACCCTGACTTCTATGCTT

CAG CCCCTGGTCATAAGCATGTGCCTGACTGGGTTTGGATTGTCGTGGGCATCCTCAACTTTGCTGCCTACACTCTAG ATGGAGTGGATGGAAAGCAA

GCACGGAGAACCAATTCCAGCACCCCGTTAGGGGAGCTGTTTGACCATGGCCTGGACAGTTGGTCGTGTGTTTACTTTGTTGTGACTGTGTACTCCATCT

TTGGACGAGGACCGACTGGCGTCAGTGTTTTTGTTCTTTATCTCCTGCTATGGGTAGTTTTGTTTTCTTTTATCCTGTCTCACTGGGAGAAGTATAACAC

AGGCGTTCTTTTCCTGCCATGGGGATATGACATTAGCCAAGTG ACTATTTCTTTTGTCTACATAGTGACTGCGGTTGTGGGAGTTGAGGCCTGGTATGA

ACCTTTCCTGTTTAATTTCTTATATAGAGACCTATTCACTGCAATGATTATTG GGTGTGCATTATGTGTGACTCTTCCAATGAGTTTATTAAACTTTTT

TAG AAGCTATAAAAGCAACACGCTGAAGCACAAGTCCGTCTATGAAGCCATGGTCCCCTTCTTCTCTCCGTGTTTGCTCTTCACTTTGTGTACAGTGTG

GATCCTCTGGTCACCTTCAGATATCTTAGAAATACACCCTAGAATATTCTACTTCATGGTTGGAACAGCTTTTGCCAATATCACA TGTCAGCTAATTGT

TTGCCAAATGAGCAGCACGCGGTGCCCGACTTTGAACTGGTTACTGCTTCCTCTCCTCTTGGTTGTGGCAGCGGTGATCGTAGGTGCAGCCACCTCCCGC

CTTGAGAGCGCCCTCCTTTACACACTCACGGCTGCCTTCACTCTGGCTCACATCCATTATGGCGTACAAGTG GTGAAGCAGCTGAGCCGACATTTTCAG

ATTTATCCTTTTTCATTGAGGAAACCAAACTCAGATTGACTAGGAATGGAAGAACAGAATATCGGCCTGTAATCTTGACAAAGTACTGTAAATAGATGCG

TGTAAATACTTCATCCATCACCAGTGAACTGAACGGATCTGCTCGGCAGACATGGGATCTCAGTGTGTGCTATATGGACAGCAAGAATGAAACCTGGGCT

CAGCTTGTGGAATTGTGGACTTTCTAACTCCCAGCTTACTCTATTTTATTTTATTTTTTTTATAGAGCCATGAGACATTTGGTTAAGCACAGTGTACATT

AAACCAGCTAAATGTTCCTAGCTTCCTGAGTCCATGGCGTTTTGACTCACAAAGTTAAAGATGATTTACTTTCATGTTTCAGGTCCCCGGGTTGAGTCAG

GAACACTAATGACATTCAGATAGCCACAGCATGTCTTAATATTTGATACGTTATGGTCGGTCTTTAGCTGTGGATCATTCCCACAGCCAAAATGTAATGC

AGAAAAGCATCAAAAAAGTCTCTTCAGCCAGAGATGCCAGTGACTCCAGAACAGGGTACAGTTGCCAAATCCCGGTTGCCCTCCAGTGAACTGCCTTCCC

CACCTGCTGTGGAGGTTGTCCAGTATCCCGGCTCTTACTGTATCTGATAAATGGTTTAATTTTCTTTTAGAGTGGAGTGTTCTGCCGTTACTTAGTAGGG

AATGGGTTGTAATTACAGTCGGCCGTTGTGGCATAGCTCATTGTCTAATTGTGGCGGTTCCTCTCTCAGCAGTGCATTGCTAGGATTGGGTGCCTGTGAG

CTGTGATTTTTAAGAATACGTGTGACAGTCCCAATCTTGTGGTACTTACTTGTGAGGATATGCAGTAGCTCGTGAGAGGAAATTTAAACTGGAGTTAGGA

GTCTCAGAGCTCCACATCGGCCACAGTTAGCACCCTGGCACTGTCTGTCCAGTTGCTGCTTGCTTTCCTTCTCCCTGGGGGTGAGCTGTTGTGGTTTTTA

TTCTCACACAGGATAACGAACGAGATTGTCTCTCTCCCCTAATTTGCCCACCTCCCTATTTGAAGAAAACTTTTGATATATATGCCTTACTGAGTATTTA

CTTCCCTTAATATGACTCAAAATAATTTTTAAGGTTTACTGACAACATAAAATAATTCCTTTCACTATATTGTGGTTATTTTATAAATCACACCTTTTTA

TGAATGTGGAGATTTTTTTTTTCCTTTGGACTTTGTCTTTATTTAGTTTTGTGGTGGTGAAATTTACTTGCTGATTTTATTTTCCACTGAATGAAGTTTG

TGCTTAAATGAAGAGTGTGTCTTAAACCCTTTTTTTTGGACAGGTTGCACTTGGATAAAATAGGCACCACTGTGTTGATATGTAATTAAATTCATAACTA

TTATTATCTATGAATGGAACCATTCTTAAATATTGTAGCTCATTCCTTTGTTGAATATCTGTCTGCTGCTTTGTAAAAACAAAACAAAAAACAAAAACAA

AACCATTGGTACGTCACGTAAACATTTTAAAATTCTAATCATTGTCGTCCAGGCTGTCGAAGATAAGCCCAGGGGCTTACGTGTATCTGGAGACATTCTC

TGAGACAAAAAATGAAAGCAAAAATTGGTGAGAAGTTGATGTGAAAATGGGTAGTGATTCTGTGCTTGTTAATAAATTGCCATCATGGAGGCTGGAAGGT

GAGCCGGTTGTGTGAGGATAACTGTTCCGTCCACCTTGTGCTCTGTGTGAGTTTGTTAGAAGGTCCTTGTTTTCTTGACCTTGTACACAGTAATATTCAT

TTGTATAAAGGAAAATAACTGATAAATATTTATAAAATAATGAATTTGGACCACAGGCTTTCTTCACCTTGTACAGTAGACTGAAAAATCATGTCCTATA

ATTTTAGGGCTTTTTTTTTTTTTCTTTCTGTTTTTCAAAATGTATGTTCTCTTTATTGCATCAAGTGGATTTAAAAGAAAATGCTTTGTGCCTTTTGTTT

GTTTGTTTTTAAACTTGCCTCTGTGATAGTAAAGAAATGTGTTTCTAGTTCTGTTGTCACTGTTGAATGGCAGAGGACGCTGCTGGCAGGGGGAAGTGGA

AGGGAGCACACAGAGTCTCAGAATCTTGTGAACTCCCACAGAACTCAGAATCCCTCCCAGCCTGCTCATGCCCTCCGTCATGGTTGTGCATCGCGAGATG

CCCATATGTTGTAGCGATACAGCGGCGGATGCGGGCTTGATTGTCAGGGGCTCTGTGTATCTCTGCCACGCCCCTTCCTGTAACTTTCCCAAGTGTAAAC

GGTACTGCAAGCTTATGCATAGTGTTTCCCAGGTGGCACGGAGTTGCCCTTTGGGAAGCAGCATCGCGGTTGGAAGTGCACACGCATGCCTTCTGTACTT

GGCCCTGGCCAGGTGCAAGTTTCTTTTCAGGCTGTGGAAAAGCCCTTTTCAAGCTTGTCAGGAAATAATCTCCCTGTGTTTGGGAGGGTGTGGGGTGCAA

AAAACATTAACAGTGCTTGGATGAAGGCTGCCACCTGGTCTTTCAATGGTATTTATGACCTTACTGCAGTTCACTATTTAAAATTGCCATAATCATTGTC

TTGGTTTTCAAAAATACTAATAGAGTTTATAGGTTTTAGAGCAATAGAGTGACTTTGAAGTAAAAATATAACCATTCTTTCTTGGCATTTCAATTATTAT

GATTGAAATACTTCTAATTCCAATTTTGAAAAAAATGTTGAGCATGTTTAGGGTGTTATAGTAGCACTGCTAATATGCCACTTGCCCACTCCTGAGGCAT

TGGGAGAGAGGTGTACATCTGGGCTTAGCACATGCTAAATACATTAAGGGAGTATATTGTAGTCAGAGTAGGTATGAAAGGCACCTTGCTTCCTGAAGCC

GACCTCAGCTCCATGATCTATGGAGGAATAAACTGGTCATTTGGAGGTTTTTAAGTCTAGGACGACTTCTTACCTTTAAAATGTAACTTGAAACCTACTT

GTAACTTTTCCTGTCACTGAGCAAGCAGTTAGGACAGAAACAGCTCTCTGCATCCCGGCTGGCTTGCAGACAGATTCATGTGGTGAATGCCTTAAATCTC

TTGGTTGGTGAAGGACTGGAAACAACACTGAGAAGGTTAAGCCTGAGGTCTGCAGCTTTGACTCTGGGTCTCCAAATTAGCCAGAAACAGATGCAGAGAT

GGAGTTGGCTGTGGGGATGCGCGTGTTTGGGATGCTCTCATCATTACTTCTGGATTTGATCAAGCCCTCTTTAGGAACTGTGACGACAGACCAGAATTTT

CTTTGTCCAATGAAATGTCATTTTAATGCAAAATATCTTGAACACTCACTGTGGGTGAGTAATTCGCTGCCCTATGCCAGCCTTCCAGGAAGGCTTTTCC

TTTATTAATTATGTAAACTAGTGGCTTGTACATATTAAATGTTTTGTTTTTGTTTCTAAATCATCTATAAATGGCTGACATCACAGCAGGCAGTGACCTC

GGGGTGTGTGGTGAATCATGGTGGTCTACCTTTTCCAGAGAGAGAGAGAGGAGGATGTGTCTGTGATGAGCGTGGGAATTGGACTTGCTGGCTGATTTAT

TTCCACTGTTTTACAAACTAAATGTAACTTACTCTCTAACCTGCATGTTAGTAGTGTGCTTTGCTGAGAGACTACGCCAGCTGGTTACCATCTGTATGAT

TTTTTAAGCAGAAATATATTCTTTTTATAGCTATCTGTTGAGCTCACGTTTAGGGTAGCAGAAGGAATTTTGACATTTGCAGCCTTTCACAGGCAGCCTG

AGCAAGGTTTGTTCATTCAGTGAGGAAGGCTGGGTTCCCCGGATGGAAAAAAAGCGCTACACACGCATTTTAGAGTATTCAATAAGGGCTTGTCTGTCGG

TAGGAAAAAACCTGTGGGTGGAACAGAAAGGAGGCTCTGGGCTTTTAGATTATTGTGATTTCCCTTTCAGAAAATCATTCTTAGAGAGCTGGATGGAGTC

AGAGCCCAGCTGCTTTAATGGCAGTTGGACCATGGCCATTGAGAGTCTAAAATAGGAGCAGAAGCCGCTGCCCTTTCAGCAGCACTAAAACGGAAATCAG

AGATGGTAGTGAGGCCAAGGACTGTCCAGTGCTATGGGTCTTTTCTATCACGTTGGCTAAGCTCTTTTAAGCAGTTTCTCTGGGTAACAGAATTCCTGGT

AAGCACGTAGGGATGGCCTGTTGAGATTGCTGTTTCTCAGCAGCAGGGAGCATCAGAGCCGCCTGCCATCTCGACTGTCGTGTTATCAGTTGGATATCCT

CATCAGAGCAGCCATCCTCCAGACAAAGACTCAGTTGTGTATATGGTTAGTTCATTCAGAATGTCCCAAGAAAGCAGAATTCAGCACTGAACTCAGAATT

TCAGTTAAACAACAAAATCTCCCCACTTTTGGGCAGAGTGGAAGACAATAATGGCCAAGGTACTCAGGAACCCAGGTTTCCTCTCCCTTCCTGCCTAACG

GTGGTAACTGAATGGTAACTGAAGAAAATTAAAGTGCTGCTTTTGTGAGTGAGGCTTCATGTTCTATGCTGAGAACAGGTAACAGGGGCTGTGTGGCTAG

GGGTTTAATTTGGTGCCTTTATGGGTAGACTTCTGAAGCAAGAGTATAATTTCTTCCCAGATACTTAAAAAACACCACGAGAACAGGTGGGGTATGTTTG

CCACAAAGAATGAAAAAGATAGCAGAGATGAAGAAAAAGAGGACATAAAATGTCTCCCCTTCCAGGTACTTTTAGTTGTAGTTGGCCTGCCTAGGGCTTT

GGTGTTAGTGTAGCGTTTGTTTACTCTGCTTCCGTGTGCTCTGCATATGTACATGTTTACTATGCATACCTGTTCTCTATGTATATATGATATGGTATCT

AATGGACTTGACTCTTGATTATCAGCCGGGTGGCAACCCTCATTAGTCTGTTGCTTTGTGTGGATTTGGCGTGCCCATGGCCCACATGGAAAGCCACTTC

CCCACCTTTCCCCTCCAGGGCATCTCAGCCCTGAGAAAGCCCTCACAGTAGATGATATTTCACTTCCCTTTCACCAGGGGACTTCGAGCCAGAAAGACTG

GTTTCCAGAATGCTGGCTATTACTTCGGGGTTGAGGTTTCTGGGTCGGCCCGGCCCTCTTTTGGCTGGGAGGCAGCTTTGGGAGCAGTGTGCTATGAACT

CCATCTGGGAGATACTTGATCTTGCTGGAGCAGAGCTTTGCCCTTGCTTCACTTTTCTGGAGTGTTGCAAGGCTTGTGATTCCATGTAGAGTAGAATATT

CTCGGTAGTTTGAATGTGGGTTTTGCATTGTCTGTGTTCTTGTCACCGGATTCTAGAAACCTTGATCTTTCAACTGGATTTATGTTTGTGTCTGCTGCTA

TAGACTCCAAAAGTTAAAGCAGTAGGTTCTAGTTTTCAATTGTTTAATTCTTTATTGATAAATATTTATTGTAATAAAAAATAAATAATTTTTAAATCTT

TTT
Translation
MAGYEYVSPEQLSGFDKYK - UNI27590 - YSALDTNPLSLYIMHPFWNTIVK KKKQVFPTWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASA A

PGHKHVPDWVWIVVGILNFAAYTLD DGVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTVYSIFGRGPTGVSVFVLYLLLWVVLFSFILSHWEKYNT

GVLFLPWGYDISQV TISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIG GCALCVTLPMSLLNFFR RSYKSNTLKHKSVYEAMVPFFSPCLLFTL

CTVWILWSPSDILEIHPRIFYFMVGTAFANIT CQLIVCQMSSTRCPTLNWLLLPLLLVVAAVIVGAATSRLESALLYTLTAAFTLAHIHYGVQV VKQL

SRHFQIYPFSLRKPNSD*LGMEEQNIGL

For any suggestions or comments, please send an email to unitrap@crg.es