Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000076434 (Wfdc3)
Chromosomal location
Chr 2: 164556680 - 164571431 (-)
Description
WAP four-disulfide core domain 3 Gene [Source:MGI (curated);Acc:Wfdc3-002]
RefSeq_dna
NM_027961 
RefSeq_peptide
NP_082237.1 
MGI
MGI:1923897 
Uniprot/SPTREMBL
A2A4Y5 Q14AE4 
Human Ortholog
ENSG00000124116 (WFDC3)
Omim not available
UniTrap UNI21043
Vector Insertion
Chr 2: 164559812 - 164568528
Public Clones not available
Private Clones OST344976 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000103096
Sequence
GCCAGCAGCCAATCACTGTTCTCATTGTCAGGAGAAGCTGTTCTTAGGGGATAATTGCTTCAGAGAAACCACTGGGATTAGATTGACAGGAGCTACTTAG

TCCTTCCTTCTGCTGCTACCTCTCCCCTGAACTGAGCTCCTGACTCTCATAGCCAGCAGGACGTTAAGACACCTCTTCCTCATGAAGGCACTTCTTGCTC

TTGGGTTCCTGGCATCTTGGGTAGCTGCAGGAGAGCACG - UNI21043 - CATTGAGAGGTGAATGTCCGGCTGACCCTCTTCCATGTCAGGAGCTG

TGTACCGGAGACGAATCCTGTCCCCAGGGGCACAAATGCTGCAGCACAGGGTGTGGCCATGCCTGCCGCGGAGACATCGAGGGAG GGCGGGATGGTCAA

TGTCCCAGAATCCTGGTAGGCCTGTGTATTGTCCAGTGCATGATGGATGAGAACTGTCAATCCGGGGAAAGGTGCTGTAAGTCAGGCTGCGGCCGCTTCT

GCATCCCAGGACTCCAGCCCCTCCAACAGCTCAAAGACTCCAACCTGACTGATGGCTTTAATTCTAAACTGG AGGCTCAAGCGCCCTAGCTGACCCGAT

TTGCTTGGAGCTCCAGGAAGCCAGGAAGGGGTGACATCCTGGGGCTTGTGACACTCCCTGGAGTATCAGGCCTTTTCCTCGTATCTACTGCTACTTGCAT

GTAGCATGGAACTGCCCTGGTGCTGGGCGCTTCTCTTTCCCAATAAAATGCTGGCATGGACCCTCTTGTCTGTACTGTGTAGGCATCACTGAGGCAGGAG

ACCCAGTGAGTCTTCCTGTGCATGGATTTGGCAGTG
Translation
MKALLALGFLASWVAAGEHA - UNI21043 - ALRGECPADPLPCQELCTGDESCPQGHKCCSTGCGHACRGDIEGG GRDGQCPRILVGLCIVQCMM

DENCQSGERCCKSGCGRFCIPGLQPLQQLKDSNLTDGFNSKLE EAQAP
Transcript ENSMUST00000109328
Sequence
ATGGGAACCGAACTGCCGCCTAGGAGCCACCTCGTCTTTGGTGTCGGGGACGACGTTGAGGCTTCCAGACCCCTGGGAGACAACGGCTGGGGACCGAGT 

- UNI21043 - CATTGAGAGGTGAATGTCCGGCTGACCCTCTTCCATGTCAGGAGCTGTGTACCGGAGACGAATCCTGTCCCCAGGGGCACAAATGCT

GCAGCACAGGGTGTGGCCATGCCTGCCGCGGAGACATCGAGGGAG GGCGGGATGGTCAATGTCCCAGAATCCTGGTAGGCCTGTGTATTGTCCAGTGCA

TGATGGATGAGAACTGTCAATCCGGGGAAAGGTGCTGTAAGTCAGGCTGCGGCCGCTTCTGCATCCCAGGACTCCAGCCCCTCCAACAGCTCAAAGACTC

CAACCTGACTGATGGCTTTAATTCTAAACTGG AGGCTCAAGCGCCCTAGCTGACCCGATTTGCTTGGAGCTCCAGGAAGCCAGGAAGGGGTGACATCCT

GGGGCTTGTGACACTCCCTGGAGTATCAGGCCTTTTCCTCGTATCTACTGCTACTTGCATGTAGCATGGAACTGCCCTGGTGCTGGGCGCTTCTCTTTCC

CAATAAAATGCTGGCATGGACCCTCTTGTCTGTACTGTGTAGGCATCACTGAGGCAGGAGACCCAGTGAGTCTTCCTGTGCATGGATTTGGCAGTGTGAA

ATCTATGGACTAAATAAAGATGGCACGTTCTTTTTTAAAAAA
Translation
 - UNI21043 -  MDENCQSGERCCKSGCGRFCIPGLQPLQQLKDSNLTDGFNSKLE EAQAP

For any suggestions or comments, please send an email to unitrap@crg.es