Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078564 (BX000432.7)
Chromosomal location
Chr 11: 121803725 - 121818021 (-)
Description
Novel zinc finger protein Fragment  [Source:UniProtKB/TrEMBL;Acc:B1AZK8]
Uniprot/SPTREMBL
B1AZK8 
Human Ortholog
not available
Omim not available
UniTrap UNI1559
Vector Insertion
Chr 11: 121806945 - 121817940
Public Clones AC0699 (sanger) CC0200 (sanger) RRR757 (baygenomics) RRR694 (baygenomics)
RRR696 (baygenomics) FHCRC-GT-S16-4F1 (fhcrc) IST14411H3 (tigm) IST11504C7 (tigm)
IST10900H3 (tigm) IST14649F10 (tigm) IST11936G4 (tigm) IST12757F3 (tigm)
IST14521F9 (tigm) IST10268H2 (tigm) IST10888D9 (tigm) IST10366B8 (tigm)
IST14595D1 (tigm) IST11262H11 (tigm) IST14954G7 (tigm) IST11846C3 (tigm)
IST14638A7 (tigm) IST12172E3 (tigm) IST13631A9 (tigm) IST14557B3 (tigm)
IST14012B1 (tigm) IST11261C11 (tigm) IST14999B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15779
Vector Insertion
Chr 11: 121806639 - 121806817
Public Clones not available
Private Clones OST499987 (lexicon) OST352729 (lexicon) OST40426 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106088
Sequence
ATGGGCCTGTGTGCTGTGCTCCTTGTCCTGCCGCTGGATTCTGTGGACTGTGCTCAGGCAAGCTCCGAAGTTGCGACATGG - UNI1559 - GATGAA

CTGACCCATGATGATGTGCATGTGAACTTCACTCAAGAAGAATGGGCTTTGCTGAATCCTTCACAGAAGAGTCTCTACAAAGATGTGATGTTGGAGACCT

ACAGGAACCTCAATGCTGTAG - UNI15779 - GCTACAATTGGGAAGACTGTAATATTGAAGATCATTATAAAAGTTCCAGGAGACATGGAAG GCA

TGAAAGAAGTGGTAATGGAGAGAAAACCCCTGAAAATACTCAATGTGGTAAAGCCTTTGCATGCCACAGTTATCCTCTAAGGCATGAAAGAATTCATAAT

GGAGAGAACCTCTATGAAGGCATTCAGTATGGTGAAGCCTTTGTACATCACAGCAGTCTCCAAATGCATAAAATAATACATAATGGAGAGAAGCAATACA

AATACAATCAATGTGATAAAGCCTATTCACAAAAAAGTATTCTCCAAATACATAAAAGAACATATACTAGAGAGAAATCTTACAAATGTAATCCATGTGG

TAAAGCCTTTGCATATCATAGTACTCTGCAAGTACATAAAAAAACACATACTGGAGAGAAACTCCATGAATGTAAGCAATGTAGTAAATCTTTTGCCTCT

CAACTTCACCTTCAAAGCCATCAAAGAAATCATACTGGAGAGACACCTTTGAAATGTAATCAATGTAATAAAGCCTTTTCTCGACAACGTTATCTCAAAA

GGCATTTAAGAATACATACTGGAGAGAAACCTTACAAATGTGATCAATGTGGTAAAGCCTTTGCATATTATACAAGTCTGCAAGTACATAAAATAACACA

TGCTGGAGAGAAACCTTACAAATGTGATCAATGTGGCAAAGTCTTTGCAGATCAAAGTTATCTTAAAGTACATAAAAAAATTCATACTGGAGAGAAGCCT

TATAAATGTGATCAATGTGGTAAAGACTTTGGAGGACACAGTCGTCTTAAAATGCATAAAATAGTACATACTGGAGAGAAACCTTACAAATGTAATCAAT

GTGGTAAAGCCTTTGTATATCATAGTACTCTCCAAGTACATAAAAGAATACATACTGGAGAGAAACTCCATGAATGTAAGCAGTGTGGTAAATCCTTTGC

CTGTCAAGGTCACCTTCAAAACCATCAAAGAACTCATACTGGAGAGAAACCTTTCAAATGTAATCAATGTGATAAAGCCTTTGCTCAAAAACGTGATCTT

AAAAGACATTTAATAACACATACTGGAGAGAAACCTTACAAATGTGATCAGTGTGGTAAAGCCTTTGCATATCATAGAACTCTTCAAGTACATAAAAGAA

TACATACTGGAGAGAAACTCCATGAATGTGATCAATGTGGCAAAGCCTTTGCAGATCAAAGTTATCTTAAAGCACATAAAAGAATTCATACTGGAGAGAA

GCCCTATAAATGTAATCAATGTGGTAAAGCCTTTGCTCAACAACGTAATCTCAAAAGGCATTTCATAACACATACTGGAGAGAAACCTTACAAATGTGAT

CAATGTAGTAAAGCCTTTGGAGATTTTCGTACTCTGCAAGTACATAAAAGAGCACATACTGGAGAGAAACTCTATAATAAATGTGATCAATGTGGCAAAG

CCTTTGCAGATCAAAGGTATTTTAAAGTACATAAAAGAATTCATACTGGAGAGAAACTCTATAAATGTGATCAATGTGGCAAAGCCTTTGCAGATCAAAG

GTATTTTAAAGTACATAAAAGAATTCATACTGGAGAGAAACCTTACAAATGTAATCAATGTGGTAAAGCCTTTGCTCAGAACTGTGACCTCTTAACACAT

CAAAGAATTCATACTGGAGAGAAACCTTACAAATGTAACCAATGTGGCAAAGCCTTTGTACGTCATTATACTCTTCAAACACATGAAAGAATACATACTA

GAGTGAAACATTATGAATGTAATCAA
Translation
MGLCAVLLVLPLDSVDCAQASSEVATW - UNI1559 - DELTHDDVHVNFTQEEWALLNPSQKSLYKDVMLETYRNLNAVG - UNI15779 - GYN

WEDCNIEDHYKSSRRHGR RHERSGNGEKTPENTQCGKAFACHSYPLRHERIHNGENLYEGIQYGEAFVHHSSLQMHKIIHNGEKQYKYNQCDKAYSQKS

ILQIHKRTYTREKSYKCNPCGKAFAYHSTLQVHKKTHTGEKLHECKQCSKSFASQLHLQSHQRNHTGETPLKCNQCNKAFSRQRYLKRHLRIHTGEKPYK

CDQCGKAFAYYTSLQVHKITHAGEKPYKCDQCGKVFADQSYLKVHKKIHTGEKPYKCDQCGKDFGGHSRLKMHKIVHTGEKPYKCNQCGKAFVYHSTLQV

HKRIHTGEKLHECKQCGKSFACQGHLQNHQRTHTGEKPFKCNQCDKAFAQKRDLKRHLITHTGEKPYKCDQCGKAFAYHRTLQVHKRIHTGEKLHECDQC

GKAFADQSYLKAHKRIHTGEKPYKCNQCGKAFAQQRNLKRHFITHTGEKPYKCDQCSKAFGDFRTLQVHKRAHTGEKLYNKCDQCGKAFADQRYFKVHKR

IHTGEKLYKCDQCGKAFADQRYFKVHKRIHTGEKPYKCNQCGKAFAQNCDLLTHQRIHTGEKPYKCNQCGKAFVRHYTLQTHERIHTRVKHYECNQ

For any suggestions or comments, please send an email to unitrap@crg.es