Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078591 (Hs3st4)
Chromosomal location
Chr 7: 131126383 - 131542503 (+)
Description
heparan sulfate (glucosamine) 3-O-sulfotransferase 4 Gene [Source:MGI (curated);Acc:Hs3st4-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36948
Vector Insertion
Chr 7: 131127408 - 131540339
Public Clones (sanger) 3SD179H12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106437
Sequence
GCGGGAGCGGTAGCCGCGGCAGCGCGGGGAGAGCGGGGCGCTGCGCACGGAGCAGGTGCCGCCGCGACTAGGCGCCCCCCTCGGGCTCCTGGCCTGAGGT

TGAGGGGGGCGGCGGGGGCTCGCGAGGGGAGGGGGCCATGCGTCCGGGCTTGTCCCCGGCGCAGCGGGACGGCAGCCAGGGCCGGGGGCGCAGCGGCGTC

GCTCCATGCAGCCGGGGCGGCTGGGCGGCGGCGGCGGCGGCGGCGGGGGCGGCGGCTGAAACCATGTCCGGGCAGCGCCGGGGGCCGCCGCCGCCGCGAG

CCGGGAGCCGCGATGGCCCGGTGGCCCGCACCGCCTCCGCCTCCGCCGCCGCCGCCGCCGCTCGCCGCGCCGCCGCTGCTGCCCGGCGCCTCCACTAAGG

GGCCGCCGGCGCGCAAGCTGCTCTTCATGTGCACCCTGTCCCTGTCCGTCACCTACCTGTGCTACAGCCTGCTGGGCGGCTCGGGTTCGCTGCAGTTCCC

GCTGGCGCTGCAGGAGCCCCCGGGATCCGCCGCGGAGCCCCCGCCGAGCCTGCTGTCTCCCTCGCTGCCGCCTCCCCGCGTGCGCCCCGGCGCCTCCTCG

CCGCCGCCGGACAACGCGAGCCGCGGGCCACCGCCCGAGCCCCCCGAGCGCTTCACGACTCCTGCGGCCGACGGCTGGGGACTGGCGAGCGGCGGCGGTG

CTCGGGACGCCTGGCCCAGGAGCCCGCCTGCCCCCGGAGACGCGGTCACAGAGCAGGACGCGCTGTTGGGGCGCGGGGCGCAGGAGCCAGGCGCAGCCGA

GGAGCTGGAAGGCCGGAGGGCGGCCAACGGGAGTGCGGAACGGGGCCCCGCCAGCACCCCTGATTATGGGGAGAAGAAGCTGCCCCAGGCACTGATCATC

GGGGTCAAGAAAGGAGGGACACGCGCGCTGCTGGAGGCTATCCGAGTCCACCCGGACGTAAGGGCAGTGGGCGTAGAGCCGCACTTCTTCGACAGGAACT

ACGAGAAGGGGCTGGAATGGTACAG - UNI36948 - AAATGTGATGCCTAAGACATTGGATGGGCAGATAACCATGGAGAAGACCCCCAGTTATTTT

GTGACGAATGAGGCTCCCAAGCGCATCCACTCTATGGCCAAGGATATCAAACTCATTGTGGTGGTACGAAACCCAGTGACCAGGGCCATTTCTGACTATA

CCCAGACACTGTCAAAAAAGCCAGAGATCCCCACCTTTGAGGTTCTGGCCTTCAAAAACCGGACCCTGGGGCTGATTGATGCCTCTTGGAGCGCCATTCG

CATTGGGATCTATGCTTTGCACCTGGAGAACTGGCTGCAGTACTTTCCCCTTTCTCAGATCCTGTTTGTCAGTGGTGAGCGACTCATAGTGGACCCTGCA

GGGGAGATGGCCAAGGTCCAGGATTTCCTAGGCCTCAAGCGTGTGGTGACTGAGAAGCACTTTTACTTCAACAAAACCAAGGGGTTCCCCTGCCTGAAGA

AGCCAGAAGACAGCAGCGCCCCAAGATGTTTGGGCAAGAGCAAAGGTCGGACTCATCCCCGAATTGACCCAGATGTCATCCATAGACTTCGGAAATTCTA

CAAACCCTTCAACATGATGTTTTACCAAATGACTGGTCAAGATTTCCAGTGGGAACAGGAAGAGGGTGATAAGTGAGGCTGATGGTGTGGAGGGAAGGCT

AATGAATAGCAAGGATACTCTTAAGCAGAGTCCCAAATCCCCCAGGTTCAGAAGTGTCAGCCATGCTGGAGTACCAAGTAGATTGCCAACCTGATCCATC

AGGTTACATCCAATGTCGTGGGCTTAGGCAGAGGTATAGATCTCATGGCATCCCTGGGGAGGAATCAACAATGTCTGGTTGACCAGATGGTTACTAAAAT

CTACCATGAATAGTATCTTCTACTAGTTAATAGTTAAAGAGGATAAACATCTTCCAATGTCACAGACAGATGCTATGTTGAGTATAAGAAAGAGAGAAAG

AGAGAGAGAGAGGGAGGGGGAGAGGGAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAGAGAAGAAAGAAAGAAAGAGAGAGGGGGAT

GGAGGGAAGGAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGTGTATTTTGCCGGAGCTCTTACTATAGTCTTGGGAGTATGGAT

TCTAGCCTTGTATTTAATCCCTGGTACATAAACTTCTGCTCTGGCATCTCTCCAGAATGCTATTTGTGACTGAGAGCACCAAGACTCCCAGGGAACAATA

TCCTCCCTCCAAGGCCTGTCTAGCCTTCCCATCAAAGGCCTCATCCCACAACCCTTTGATTTCCTCCCTCCCCACAATATGAAGGCAAAGGCATGCACGT

ATGTTCTTCACCAAAAATAAAATAAAATAAAATAAAACAAAACAAAAAATAGCCTATACCCCCTAGAGCCTTCTATCTGAGAGCCATCCAAGGTGGGTCT

CTCTCTTCATGAGCGTTCTAAATTACAGAGAAGCTTAGCACATCCTCATATTGGGATCTGGCCTACATGAATGCTCCCAGAACAGGGAGATAGCATCTGT

GTTTTGAGCCCTGAGGTTGGCAAAGATGAATGCTTGTAACTGTGGGTATCAGGCAAACCCCAGCCTCTTGGTGGGTGGCCCCTTATCTAAAGACCCTTGT

TCCTAAGGATCGTGGTCCTGGGGCATGCTCTAAGGGATAGGCTCTGCTCTGGAGGCAAAGACAGAGCTTGCTTGTTAGTTGTTCACAGACACCCTTCCAA

ATGTGAAGAGGAAGGGAGTACCCAATGTTTTTTGTTTGTCTTGATGCTGCCCCCTCAGGGTCACCTCATGGTTCATTTTTCTCTACTCAGAGATGGCATT

CATTGGGCCATTGGCAAGAACGCTGCTGCTTTGCAGTGTGAAGTGGATTGAGGAGGGCAAGGACTGTCTGCAGACATCCTTTTCAAGGGCTGCCAAATAA

AGTGTCCCTTCCCATTAGTATGGTTCAATTAAAACACAGCGTTTGACATAAAGCACTTGTTTCTCAGATCTCCAAAGCCAGGAATTGTAGTAAAATTGGA

AATGTGTATGAGTGGGGAGAGTTGAATCTGTTCAGCTGTTATTAAACTGTCATTTCTCCCACTAAATGGAAACTGTGTTGTTATAAAGCTTAATGCAACC

TGA
Translation
MARWPAPPPPPPPPPPLAAPPLLPGASTKGPPARKLLFMCTLSLSVTYLCYSLLGGSGSLQFPLALQEPPGSAAEPPPSLLSPSLPPPRVRPGASSPPPD

NASRGPPPEPPERFTTPAADGWGLASGGGARDAWPRSPPAPGDAVTEQDALLGRGAQEPGAAEELEGRRAANGSAERGPASTPDYGEKKLPQALIIGVKK

GGTRALLEAIRVHPDVRAVGVEPHFFDRNYEKGLEWYR - UNI36948 - RNVMPKTLDGQITMEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVT

RAISDYTQTLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLSQILFVSGERLIVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTK

GFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNMMFYQMTGQDFQWEQEEGDK

For any suggestions or comments, please send an email to unitrap@crg.es