Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078607 (1810010H24Rik)
Chromosomal location
Chr 11: 106889677 - 106891268 (+)
Description
RIKEN cDNA 1810010H24 gene Gene [Source:MGI Symbol;Acc:MGI:1916316]
UniGene
Mm.40679 
MGI
MGI:1916316 
Uniprot/SWISSPROT
Q08AU9 
Human Ortholog
ENSG00000186665 (C17orf58)
Omim not available
UniTrap UNI13736
Vector Insertion
Chr 11: 106889872 - 106890898
Public Clones CMHD-GT_524D9-5S (cmhd) CMHD-GT_482A7-3 (cmhd) CMHD-GT_255G4-3 (cmhd) CMHD-GT_234H7-3 (cmhd)
CMHD-GT_269H3-3 (cmhd) CMHD-GT_517D9-5S (cmhd) CMHD-GT_517D9-3 (cmhd)
Private Clones OST451771 (lexicon) OST447667 (lexicon) OST357343 (lexicon) OST307621 (lexicon)
OST277431 (lexicon) OST266645 (lexicon) OST251007 (lexicon) OST199968 (lexicon)
OST179417 (lexicon) OST115658 (lexicon) OST103564 (lexicon) OST74657 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106767
Sequence
CAGCGGTGAATGGAATCGTGCACGACGTGGACGTGTTGGGCGCGGGCATGCGCCTGGTGACTCTTCTGGTGGACCCCGACGGGCTGTACAAGATGAGCCG

CCTGTACATCACTCCCGACGGCTTTTTCTTCCGCGTGCATATACTAGCCCTGGACTCCTCCAGTTGCCATAAGCCGTGTCCAGAATTTAAACCCG - UN

I13736 - GAAGCAGGTATATTGTGATGGGCCACATCTACCATAAGAGACGGCAGCTCCCCAGTGCGCTGCTCCAGGTCCTAAGGGGGCGCCTGCGTCC

AGGAGACGGGCTGATCCGGGGTAGCAGCAGCTACGTGAAGAGGTTTAACCGAAAGCGGGAGTGGCAAGTTCGAGGTGCCACCCACACCCAGTGCATTTGA

ACTTGGCACTTGGGGTCGGTCTTCACGTGACGGGAAGCTTCTGTGAAACCGGGCTACCTTATGGACTCCGTGTGCGGCTTAGCTGTCACTTTATCTACAA

AATGCTGACAGGTGTGCTTCAGGACACTGTGCGAAAGTCCCTCGAGGGCAGTCATGCACACAACCCAGACACCAGACCC
Translation
MSRLYITPDGFFFRVHILALDSSSCHKPCPEFKPG - UNI13736 - GSRYIVMGHIYHKRRQLPSALLQVLRGRLRPGDGLIRGSSSYVKRFNRKRE

WQVRGATHTQCI

For any suggestions or comments, please send an email to unitrap@crg.es