Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078619 (Smarcd2)
Chromosomal location
Chr 11: 106124493 - 106134122 (-)
Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 Gene [Source:MGI (curated);Acc:Smarcd2-001]
RefSeq_peptide
NP_001123659.1 NP_114084.2 
UniGene
Mm.21772 
MGI
MGI:1933621 
Uniprot/SWISSPROT
Q99JR8 
Uniprot/SPTREMBL
B1ARI6 B1ARJ6 Q3TM59 Q3TXH6 B1ARI7 B1ARI5 
Human Ortholog
ENSG00000108604 (SMARCD2)
Omim not available
UniTrap UNI949
Vector Insertion
Chr 11: 106128007 - 106128204
Public Clones BB0591 (sanger) CJ0385 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021052
Sequence
GTAAAATCGGGAAGTCCCGGATCGCGGAACGTAGCTCGCGGAGCGGACTCAACACGGAGACCGGAGGCCGGATCGCTGCACCGCGGGACGGGACAGAGTG

ATGTCCGGCCGTGGCGCGGGCGGGTTCCCGCTGCCTCCGCTGAGCCCCGGCGGCGGCGCCGTTGCCGCGGCCCTTGGTGCGCCGCCTCCGCCTGCGGGAC

CCGGAATGCTGCCCAGCCCGGCGCTCAGGGGCCCGGGGCCTTCTGGAGGCATGGGGGTACCGGGGGCCGCCGCCTTCCGCCCCATGGGCCCCGCTGGCCC

CGCGGCGCAGTACCAG CGTCCTGGCATGTCACCAGGAAGCAGGATGCCCATGGCTGGCTTGCAGGTGGGACCTCCTGCCGGTTCCCCATTTGGCACAGC

TGCTCCGCTCCGACCTGGCATGCCACCTACCATGATGGATCCATTCCGAAAACGCCTGCTTGTGCCTCAGGCCCAGCCCCCGATGCCTGCCCAGCGCCGA

GG GTTAAAGAGGAGGAAGATGGCAGATAAGGTTCTACCTCAGCGA ATCCGGGAGCTTGTCCCAGAGTCTCAGGCATACATGGATCTTTTAGCTTTCGA

GAGGAAGCTGGACCAGACCATCGCTCGCAAGCGGATGGAGATTCAAGAGGCCATCAAGAAGCCTCTGACG - UNI949 - CAAAAGCGAAAACTTCGG

ATCTATATTTCCAATACATTCAGCCCCAGCAAGGCGGATGGAGATAATGCGGGAACTGCGGGGACCCCTGGGGGAACCCCGGCAGCAGACAAGGTGGCCT

CCTGGGAGCTTCGAGTAGAGGGGAAACTGCTGGATGAT CCTAGCAAACAGAAGAGGAAGTTCTCATCATTCTTTAAGAGCCTTGTGATTGAGTTGGACA

AGGAACTCTATGGGCCGGACAACCATCTGGTGGAG TGGCATCGGATGCCCACCACACAGGAAACAGATGGCTTTCAGGTGAAACGGCCAGGAGATCTCA

ATGTCAAGTGCACCCTTCTGCTCATGCTGGATCATCAG CCTCCTCAGTATAAACTGGACCCCCGCCTGGCGAGGTTGCTGGGAGTGCACACACAGACCA

GGGCGGCAATCATGCAGGCACTGTGGCTTTACATCAAACACAACCAGCTGCAGGACGGCCATGAGCGCGAGTACATCAACTGCAATCGTTACTTCCGCCA

G ATCTTCAGTTGTGGCCGACTCCGTTTCTCCGAGATTCCCATGAAGCTGGCTGGATTGCTGCAGCATCCAGACCCCATTGTTATTAATCATGTCATTAG

 TGTGGATCCTAATGACCAAAAGAAGACAGCCTGCTATGACATTGATGTAGAGGTTGATGACCCACTGAAGGCCCAGATGAGCAACTTCCTGGCCTCTAC

CACCAACCAGCAGGAGATTGCTTCTCTTGACGTCAAG ATCCATGAGACCATTGAGTCCATCAACCAGCTAAAGACCCAGAGGGATTTCATGCTCAGCTT

TAGCACCGAGCCCCAGGACTTCATCCAGGAGTGGCTCCGTTCCCAACGCCGAGACCTCAAG ATCATCACAGATGTGATTGGAAACCCTGAGGAGGAGAG

ACGAGCTGCTTTCTACCACCAGCCCTGGGCTCAGGAAGCAGTGGGGAGGCACATCTTTGCCAAG GTGCAGCAGCGAAGGCAGGAACTGGAACAGGTGCT

GGGAATTCGCCTGACCTAACTGCTCAGGGATTGCCTCCTTCCTTCCTCCCCTGCCCTGGATGGAACCTGGCAAGAGCCCGTCCTCTGGGTTCTGGCTTGG

GCTGCAGACATGTAGGATGGAGTGAGGTGTGTTTCCTGTCACCCTCCACTCCCCAGCTTTAGTTTCATAAATGTAGTTTTAGATCCCTCACTGCTTGGTT

CCCAAAGCCTTATTACTGACCTTTTAGCGCTGGCTTTAATTGGGTTTGCAATGAGCGGCCTCAGCCCCCTGCAGGCAGGCAGGCCTGAGTAGGAGGCTGG

AGGCTGTGCTTTAACTTTGTACCAGACATTTCCAAACCAAAGGCTGCTGGGTTTGCATGTTTACAGGCTCCACCCTAGGGCCAGTGCCAGAGCTGGCTTT

GGGGAGCTGGGCAAGGAAGAGAAGGCCCTAGACTCTTCCTGGCCTTTCTAACCAAAGTTTTTTGCCATTCCTACAAGCCCAGTCTTGCTGCTGGTTTGTC

CTTCTTTTTGGGTATTTGCACTATTTGGGGAGCAGGTTTTTCTATGTGGGAGCCACTTTTTTGTACAGAGGTAATGGGGTTTTTCAGGGAGCCCACTTGG

TGCCTCCTTCTTCCTTTCTTTTCTTAATCTATGCAAGCGGCTGCAGCCGCCATCATCTCCTGGTATGCCACAAGGCTGCCCACCCATAGCTGCTTGGGCA

GGGGGAGGTGGAATCTCCTGAGAGTGGCAATGCCAGTTCTCTAACCCAGTTACAGCAGGGGTGTGTGTGCGTGCGTGCGTGCGTGCTGCAGGGGAAGGGG

AAAGCTGGAGGACTGCTGTTACCTTTTGCAGTCGGTCTTAAAGAGGATGGGCCTAAGGCTTGGCAAACTTGGAAAATTCCAAATAAATCTTTTTGTTTAT

TGGT
Translation
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPSPALRGPGPSGGMGVPGAAAFRPMGPAGPAAQYQ RPGMSPGSRMPMAGLQVGPPAGSPFGT

AAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRG GLKRRKMADKVLPQR IRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLT - UNI9

49 - QKRKLRIYISNTFSPSKADGDNAGTAGTPGGTPAADKVASWELRVEGKLLDD PSKQKRKFSSFFKSLVIELDKELYGPDNHLVE WHRMPTTQE

TDGFQVKRPGDLNVKCTLLLMLDHQ PPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQ IFSCGRLRFSEIPMKLAGL

LQHPDPIVINHVIS SVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVK IHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRR

DLK IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAK VQQRRQELEQVLGIRLT
Transcript ENSMUST00000106843
Sequence
GTTGATTAGTACTAAAAAGTCCCTCAGGCCCTTCCTTCTGCAAGAGGTACACTCCTCCCCCTCCCACCCATGGACTCTGGCTGCCTCATTTGTTGGCAAG

GCTGCCAGGGCGGTTGCAGGGGCGGGGCAGGTGTAGTTTACACGCTGGGCTCAGGCGCCTGTTCCCCTTTGTTCCTGGTCTCCCCATTTGAGAGAGAGAG

AGAGAGATGGAGGGTATGGGCTATGGACCTCGGAGGGCTCCGCCACTGACCTGTGTCCCTCCACTGTTCCACTTTCCTCAGCGTCCTGGCATGTCACCAG

GAAGCAGGATGCCCATGGCTGGCTTGCAGGTGGGACCTCCTGCCGGTTCCCCATTTGGCACAGCTGCTCCGCTCCGACCTGGCATGCCACCTACCATGAT

GGATCCATTCCGAAAACGCCTGCTTGTGCCTCAGGCCCAGCCCCCGATGCCTGCCCAGCGCCGAGG GTTAAAGAGGAGGAAGATGGCAGATAAGGTTCT

ACCTCAGCGA ATCCGGGAGCTTGTCCCAGAGTCTCAGGCATACATGGATCTTTTAGCTTTCGAGAGGAAGCTGGACCAGACCATCGCTCGCAAGCGGAT

GGAGATTCAAGAGGCCATCAAGAAGCCTCTGACG - UNI949 - CAAAAGCGAAAACTTCGGATCTATATTTCCAATACATTCAGCCCCAGCAAGGCG

GATGGAGATAATGCGGGAACTGCGGGGACCCCTGGGGGAACCCCGGCAGCAGACAAGGTGGCCTCCTGGGAGCTTCGAGTAGAGGGGAAACTGCTGGATG

AT CCTAGCAAACAGAAGAGGAAGTTCTCATCATTCTTTAAGAGCCTTGTGATTGAGTTGGACAAGGAACTCTATGGGCCGGACAACCATCTGGTGGAG 

TGGCATCGGATGCCCACCACACAGGAAACAGATGGCTTTCAGGTGAAACGGCCAGGAGATCTCAATGTCAAGTGCACCCTTCTGCTCATGCTGGATCATC

AG CCTCCTCAGTATAAACTGGACCCCCGCCTGGCGAGGTTGCTGGGAGTGCACACACAGACCAGGGCGGCAATCATGCAGGCACTGTGGCTTTACATCA

AACACAACCAGCTGCAGGACGGCCATGAGCGCGAGTACATCAACTGCAATCGTTACTTCCGCCAG ATCTTCAGTTGTGGCCGACTCCGTTTCTCCGAGA

TTCCCATGAAGCTGGCTGGATTGCTGCAGCATCCAGACCCCATTGTTATTAATCATGTCATTAG TGTGGATCCTAATGACCAAAAGAAGACAGCCTGCT

ATGACATTGATGTAGAGGTTGATGACCCACTGAAGGCCCAGATGAGCAACTTCCTGGCCTCTACCACCAACCAGCAGGAGATTGCTTCTCTTGACGTCAA

G ATCCATGAGACCATTGAGTCCATCAACCAGCTAAAGACCCAGAGGGATTTCATGCTCAGCTTTAGCACCGAGCCCCAGGACTTCATCCAGGAGTGGCT

CCGTTCCCAACGCCGAGACCTCAAG ATCATCACAGATGTGATTGGAAACCCTGAGGAGGAGAGACGAGCTGCTTTCTACCACCAGCCCTGGGCTCAGGA

AGCAGTGGGGAGGCACATCTTTGCCAAG GTGCAGCAGCGAAGGCAGGAACTGGAACAGGTGCTGGGAATTCGCCTGACCTAACTGCTCAGGGATTGCCT

CCTTCCTTCCTCCCCTGCCCTGGATGGAACCTGGCAAGAGCCCGTCCTCTGGGTTCTGGCTTGGGCTGCAGACATGTAGGATGGAGTGAGGTGTGTTTCC

TGTCACCCTCCACTCCCCAGCTTTAGTTTCATAAATGTAGTTTTAGATCCCTCACTGCTTGGTTCCCAAAGCCTTATTACTGACCTTTTAGCGCTGGCTT

TAATTGGGTTTGCAATGAGCGGCCTCAGCCCCCTGCAGGCAGGCAGGCCTGAGTAGGAGGCTGGAGGCTGTGCTTTAACTTTGTACCAGACATTTCCAAA

CCAAAGGCTGCTGGGTTTGCATGTTTACAGGCTCCACCCTAGGGCCAGTGCCAGAGCTGGCTTTGGGGAGCTGGGCAAGGAAGAGAAGGCCCTAGACTCT

TCCTGGCCTTTCTAACCAAAGTTTTTTGCCATTCCTACAAGCCCAGTCTTGCTGCTGGTTTGTCCTTCTTTTTGGGTATTTGCACTATTTGGGGAGCAGG

TTTTTCTATGTGGGAGCCACTTTTTTGTACAGAGGTAATGGGGTTTTTCAGGGAGCCCACTTGGTGCCTCCTTCTTCCTTTCTTTTCTTAATCTATGCAA

GCGGCTGCAGCCGCCATCATCTCCTGGTATGCCACAAGGCTGCCCACCCATAGCTGCTTGGGCAGGGGGAGGTGGAATCTCCTGAGAGTGGCAATGCCAG

TTCTCTAACCCAGTTACAGCAGGGGTGTGTGTGCGTGCGTGCGTGCGTGCTGCAGGGGAAGGGGAAAGCTGGAGGACTGCTGTTACCTTTTGCAGTCGGT

CTTAAAGAGGATGGGCCTAAGGCTTGGCAAACTTGGAAAATTCCAAATAAATCTTTTTGTTTATTGGTGG
Translation
MEGMGYGPRRAPPLTCVPPLFHFPQRPGMSPGSRMPMAGLQVGPPAGSPFGTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRG GLKRRKMADKVL

PQR IRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLT - UNI949 - QKRKLRIYISNTFSPSKADGDNAGTAGTPGGTPAADKVASWEL

RVEGKLLDD PSKQKRKFSSFFKSLVIELDKELYGPDNHLVE WHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQ PPQYKLDPRLARLLGVHTQTRA

AIMQALWLYIKHNQLQDGHEREYINCNRYFRQ IFSCGRLRFSEIPMKLAGLLQHPDPIVINHVIS SVDPNDQKKTACYDIDVEVDDPLKAQMSNFLAS

TTNQQEIASLDVK IHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLK IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAK VQQRRQELE

QVLGIRLT
Transcript ENSMUST00000106841
Sequence
AATAGAAGGAAGAGAAATGAGATGGCTCTTGGAAAACAGAATTCACCCTGAAACCTTACTCATAGGATAGACGTGGTGGTTGGGATGAAGATAGCCATGT

TTTTCCATGCTTTTCTGTGCTGCCTGCAGTGTGGATCCTAATGACCAAAAGAAGACAGCCTGCTATGACATTGATGTAGAGGTTGATGACCCACTGAAGG

CCCAGATGAGCAACTTCCTGGCCTCTACCACCAACCAGCAGGAGATTGCTTCTCTTGACGTCAAG ATCCATGAGACCATTGAGTCCATCAACCAGCTAA

AGACCCAGAGGGATTTCATGCTCAGCTTTAGCACCGAGCCCCAGGACTTCATCCAGGAGTGGCTCCGTTCCCAACGCCGAGACCTCAAG ATCATCACAG

ATGTGATTGGAAACCCTGAGGAGGAGAGACGAGCTGCTTTCTACCACCAGCCCTGGGCTCAGGAAGCAGTGGGGAGGCACATCTTTGCCAAGGTGAGGCT

TTGCCATTTTGGCCTCCGCTTTTCTTGAGAAGCTGAAGCCTGAGGCTTGCTTTGTCGTCTTCTTCAGGTGCAGCAGCGAAGGCAGGAACTGGAACAGGTG

CTGGGAATTCGCCTGACCTAACTGCTCAGGGATTGCCTCCTTCCTTCCTCCCCTGCCCTGGATGGAACCTGGCAAGAGCCCGTCCTCTGGGTTCTGGCTT

GGGCTGCAGACATGTAGGATGGAGTGAGGTGTGTTTCCTGTCACCCTCCACTCCCCAGCTTTAGTTTCATAAATGTAGTTTTAGATCCCTCACTGCTTGG

TTCCCAAAGCCTTATTACTGACCTTTTAGCGCTGGCTTTAATTGGGTTTGCAATGAGCGGCCTCAGCCCCCTGCAGGCAGGCAGGCCT
Translation
MLFCAACSVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVK IHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLK IITD

VIGNPEEERRAAFYHQPWAQEAVGRHIFAKVRLCHFGLRFS

For any suggestions or comments, please send an email to unitrap@crg.es