Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078669 (AC113019.13)
Chromosomal location
Chr 7: 82600443 - 82748187 (+)
Description
Putative uncharacterized protein Fragment  [Source:UniProtKB/TrEMBL;Acc:Q3TA34]
Uniprot/SPTREMBL
Q3TA34 Q3TZA8 
Human Ortholog
not available
Omim not available
UniTrap UNI5022
Vector Insertion
Chr 7: 82600635 - 82679693
Public Clones (sanger) YTC453 (baygenomics) E079D10 (ggtc) IST10062B2 (tigm) IST14523A10 (tigm)
IST14271C8 (tigm) IST14362D4 (tigm)
Private Clones OST172782 (lexicon) OST170928 (lexicon) OST96521 (lexicon) OST68682 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI800
Vector Insertion
Chr 7: 82679738 - 82714769
Public Clones AC0258 (sanger) CH0266 (sanger) AF0454 (sanger) AE0301 (sanger)
Private Clones OST297969 (lexicon) OST149572 (lexicon) OST116395 (lexicon) OST68100 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI654
Vector Insertion
Chr 7: 82714918 - 82724387
Public Clones DC0594 (sanger)
Private Clones OST230036 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026850
Sequence
CTGTGTGCAGGGCGGTCGCAGAGCCGGAGCTGCTGCTGCTAAGCTCTTGGGCTCGGTTGAGACCGCCGTGCTTGCTCCTTGCTCCAGCCGTCACCGCCGC

CGCCGAGGGAGCGGCCGCCTATTGTCCTTCTCCGCGGCCAAGGCGCGGAGCTGCTCCGGCTCGGCCCGCGGGGGAGCCCGGGGAGCCGCACG - UNI50

22 - TGTCCTGGGTCATGAAACTTAGTCCACAACAAGCTCCATTATAT - UNI800 - GGCGATTGTGTTGTTACAGTATTGCTTGCTGAAGAGGAC

AAAGTTGAAGATGATGCTATTTTTTACTTGATATTTTCTGGCTCTACCCTCTATCACTGCACAAGTACCCGGAAAGTCAGTTCTGATACGTTGGAGACAA

TTGCTCCTG - UNI654 - GTCACGACTGCTGTGAGACAGTGAAGGTGCTGCTCTGTGCTTCCAGAGAGGGCCTTCCTGTGTTTGTAGTCGCTGAAGA

AGACTTCCATTTCGTCCAGGATGAGGCGTATGATGCAGCTCAGTTCCTGGCAACCAGTGCTGGAAATCAGCAGGCTCTGAACTTCACACGGTTCCTCGAT

CGATCAGGACCTCCTTCTAGAGATGTGAACTCTCTCGATGAGAAGGTGGCACTGGCATTCAGACACCTGAAGCTGCCTGCAGAATGGAACGTGTTAGGGA

CAGATCACACTTTGCATG ACGGTGGCCCTCGGGAAACCCTGATGCACTTTGCTGTGCGGCTGGGACTGCTGCGGTTGACATGGTTCCTGTTACAGAAGC

CAGGTGGCCGTGGAGCTCTCAGCATCCACAACAAGGAAGGGGCAACGCCTGTGAGCCTGGCACTGGAGCGAGGTTATCACGAACTTCACCAGCTTCTGAC

TGA GGAAAATGCAGGGGAGCCAGATTCCTGGAGCAGCTTATCCTATGAAATCCCTTATGGCGACTGTTCAGTGAGGCACCATCGAGAACTGGACATCTA

CACATTGACTTCTGAATCCGAGTCACATCGTGAACCCCATGGAGACAGCTGTACTGGACATATTTCTAAACTTATGAATATCCAACAGCAGCTGATGGTA

AGGGAAAGTTTTCATTTTTAGTTAAGTGTCTGTCTATGTCCCTCACCCAGTGAATCTTGCTATAATTAAGATGTGAATTTATAAAGCATTGTTATTATAC

AGTGTTGCTGTGTTGGTTAGTATTTTTGTCAACTTGACACAAGCCAAGAGCCATTTTGCAAAAGGGAACCTCACTTGAGAAACACCTGAATCAAATTGCA

AAGGTTTAACGCTGGGCAGGTATTCCCGGGTTGTATATGAAAGCTGAGCAAGCTGTTGGGTAGAACCACTGGCTTTTCCACCCATGCCTGAGTAACGATT

CAGAGGCTTATTATTTATTC
Translation
 - UNI5022 - MKLSPQQAPLY - UNI800 - GDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCTSTRKVSSDTLETIAPG - UNI654 - GH

DCCETVKVLLCASREGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLDRSGPPSRDVNSLDEKVALAFRHLKLPAEWNVLGTDHTLHD D

GGPRETLMHFAVRLGLLRLTWFLLQKPGGRGALSIHNKEGATPVSLALERGYHELHQLLTE EENAGEPDSWSSLSYEIPYGDCSVRHHRELDIYTLTSE

SESHREPHGDSCTGHISKLMNIQQQLMVRESFHF

For any suggestions or comments, please send an email to unitrap@crg.es