Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078796 (Zfp541)
Chromosomal location
Chr 7: 16657291 - 16681677 (+)
Description
zinc finger protein 541 Gene [Source:MGI Symbol;Acc:MGI:3647699]
RefSeq_dna
NM_001099277 
RefSeq_peptide
NP_001092747.1 
UniGene
Mm.290718 
MGI
MGI:3647699 
Uniprot/SPTREMBL
Q0GGX2 
Human Ortholog
ENSG00000118156 (ZNF541)
Omim not available
UniTrap UNI20168
Vector Insertion
Chr 7: 16668922 - 16675145
Public Clones not available
Private Clones OST370338 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108509
Sequence
ATGGAGCCATACAGTCTTGGGGAAGAGGGAGCACTTCCATCAGAAGGGCACCTCCCATCCTTCTCTGAAAGTCAAGTGCTCAACTGCAGTGACACACTCA

ACCGGGACCTGGGCCCCAGCACACGGGACCTGCTCTACGCTGGCTTAAGCGGTTTGGACCTTGACCCCAGTCTCTCCACATCTGATATGCCCAGTGAAGT

GCTAGAGGACAATCTGGACACCCTGTCCCTATACTCGGGGAAGGACAGTGACTCTGTGAAGCTGCTGGAAGAATATGCAGACTCTGAGTCACAGACCTCC

TTACAAG ACCTGGGGCTGGGCGCACTCAAGGTGCCTAAAGAGGCTGATGAAGGAGGCAGGGCCACTGGGAGTACAAGGAAAGGCAAGCGACAGCACAGT

TCCCCTCAGAATCCACTCCTGGACTGCAGCCTGTGTGGGAAAGTGTTCAGCAGCGCCAGTTCCCTGAGCAAGCATTACCTGACGCACAGCCAGGAGAGAA

AACACGTGTGCAAAGTCTGCAGCAAAGCCTTCAAGCGGCAGGACCACCT GACTGGGCACATGCTCACCCACCAGAAGACCAAGCCCTTTGTGTGCATTG

AGCAAGGTTGCAGCAAGAGCTACTGTGACTACCGCTCGCTGCGCCGCCACTATGAAGTCCAGCATGGAGTATGCATCCTGAAGGAGACTCCACCAGAAGA

GGAGGCCTATGGGGACCCAACTCACAACCATGATGTGGCTAACCAGCCTCCACCCAGTGGCCTGAGGTCCCTGGGGCCCCCAGAAGCTAGGTCCCCTGGC

TCTGTCTTGCCCAACAGAGACCTCCTTCGCTGTATTGTGAGCAGCATCGTCCACCAGAAGATTCCTTCTCCTGGCCCAGCAGTGGGGCCTTCTGATACTG

AAGCAAGGAGCTCAGCCTGTGCTTGCCCCACCTCACTGGGATCATCATCATGTACACCAGCCAGCACCCCAGTGGCCCTAGGAACCCTGGGCTCTGAGAT

TCCTGAGGAAACTCATCCCCCACGGAAGGAAGCTGCCACCGAAGTGTTCACACCTGTCCAGTCAAGGGCAGCTGAGAATGGTGTCCCCGATCCACCAGAG

TCAGAGTTGGAGTCAGAGTCTCCACGGCTTCAACGGCCATCCTCCCTGGAAGGCTGGCCAGAGGGCAGCTCTCTGCCTGCCTGCCTGCCTCTCTTCAGAG

GCCACTCTGTCCCCTCAGGATCCCAGCCTTCCAGCCACAACTTCCAGTGGCTCCGGAACCTGCCTGGCTGTCCCAAGAACAAAGGCAGCAATGTGTTTAT

GGTCCACAAGCCCCCTGCAGTGGCATCCCGGGAGGGCTCTGAGGGAGGAGGCTCTGGACCCAGCAGCACCCCTACCTCAGTGGAGCCTTCACCCAGCCTG

GGCACCACCCAGGAGGAACTCTTGCCATTTCCTCCTGCACTACTAAAGGCCCCTGGTGAGGCCTCCAGTGAAGTTCGGCAGGCAGCTGGGGAAGATGAAA

CCTGGGCTCCCAAAAAGTGCAAACCTGACTGTGAGTCATTCCCATGGCAGAGCCCCACTGAGCTTGGGCTCCAAGATGCACAGAACCCAGGTGGGCTCCC

CTCAGATGCCACGCCCCTCTTCCGGCAGCTGTTCATGAAGTCACAGGAGTCTCTAGTAAGCCATGAGCAGATGCAGGTGCTCCAGATGATTGCCAAGTCC

CAGCGGATCTTCTCCCATACTCAGGTGGCTACAGCCTCAGCCCAGAGACCAGGGCCCGAGGGCAAGCAGTCCACTCTGAAGCCATTGCAGGGGCCATGGC

CACCACAAACTCTGCCACCAGCACCCACTGTAGACTCTTTCCAGATAGGCCCTGGACACTCAGAGCCAGAAGGATCCCCAGTCCGCAGGAGGAAAACTAT

GCCTGCGGTGTCCAGAGAAACATCTCCTGGTGGCCCTAGGCGAGACACAAAAGGAGGCCCCAAAGTGGCCTCTGCACCACCATCCCTCACAGGGCCAGGC

CTGCTCCCCTCCCGGAATCCAGACAGCTCTTCATTGGCCAAAGGGACATTGGACCTGGGGGACATTATCCCCAATGCAGGCTCAAGGCAGTCCCAGTTAG

GTGGAGATGAGCCAGCTGGAACCCAGCTGGTTGGGAAACAGGGGCAAGGAGAAAATGGCCTGGCTTCAGGGGCCATGAGAGGTGAGAAGGGTCCAGCCTG

CCCCCGAGGTGGAGGCTACAGGCTCTTCTCAGGGCACCCCAGGGCCCAGAGATTCTCAGGTTTCCGGAAGGAGAAAGTGAAGATGGATGTGTGCTGTGCA

GCTTCTCCCAGCCAGGTGGCCATGGCCTCCTTTTCATCGGCTGGGCCTCTGGCAGATCCACCCAGAGACATGAAGTCCAAGCTGACAATCTTCAACAGAA

TCCAG GGTGGAAACATTTACAGACTCCCCCATCCAGTGAAGGAAGAGAGCTTGGCAGGCGGATG CCATCAGCCAAATGGGGGTCCCACAGACTGGATG

GAGTCAAAGAGCACTTTTGTGTGCAAGAATTGCAGCCAGATGTTTTACACCGAGAAAGGGCTGAGCAGCCACATGTGTTTCCATAGTGACCAGTGGCCAT

CACCTCGAGGGAAGCAGGAGCAACAGGTGAAGGGGCAAATGGTGGCTTCTGTA AAAAGGAAGGCTGGCAGGGAGGAAGGAGCAGTAGAAGATATGAAAC

GTCATTATGATTGCA GCAGCTCTGAGCCTCAGGATGTCACCATACTGAGTATGTTAGTCAGCTCTGGCTCATGTGGG GTGACACCTGTGGTTCTGTCC

TCTCTTCTTCAGGGACAAGAAAAAGATGGGGAAGAGAGAGACAGCAAGGAGAGCTGCCAGTACAGAAAGCGGAAGAAGCGGCCCCAGCCCAAGGCCCTGT

TTGCCCCTCCTGCACCCTCTGCCCTCGGGGAACCAGGCCCAGGAGGGTGCCACCAGAGCTGCCTGCACTCTCCTGTGTTCCTGGTGGATCACCTCCTGAA

GGGCTTGTTTCAGTGCTCTCCCTACACACCACCGCCTATGCTTAGCCCGATTCGTGAGGGCTCTGGGCTGTACTTCAATACCCTCTGCTCCACATCCAGG

GCTGGGCCCCACCTTATCAGCCCTGTACTTG - UNI20168 - ACCAAGTGGACAGCTCCTTTGGCATCTGTGTGGTGAAGGATGACACTAAAATCAG

CATCGAACC ACATATCAACGTAGGAAGCAGATTTCAGGCGGAGATCCCAGAACTGCAGGAGAGGCTGCTGGCCAGAGTGGATGAGAATGTAGCTTCTCT

GGTCTGGAAGCCATGGGGAGATGTGATGACCAACCCAGAGACCCAGGACAGAG TGATGGAGCTCTGCAATGTAGCATGCTCCAGTGTGATGCCAGGAGG

GGGCACCAACCTGGAGCTTGCCCTGCACTGCCTGCATGATGCCCAGGGCAGTGTTCAG GTTGCCCTGGAGACTCTGTTACTCAGAGGACCCCAGAAGCC

CCGGACTCACCCACTGGCTGACTATCGATACACAG GTTCAGACATCTGGACCCCCATGGAGAAGAGGCTCTTCAAGAAGGCATTCTGTGCCCACAAGAA

GGACTTTTACCTGATACACAAGATG ATCCAGACTAAAAGTGTAGCACAGTGTGTCGAGTACTACTACATCTGGAAAAAGATGGTTAAGTTTGATTGTGG

CCGAGCTCCTGGGCTGGAGAAGAGGGGCAGAAGAGAGCTGGATGAAGTAGAAAGGACTGAAGACAAG GTGACTTGCAGCCCTCGAGAGAGACCTACCCA

CCGTCCAACTCCTGAGTTAAAGATAAAGACCAAGAGTTACAGGAGAGAGTCTATCCTTCACTCCAGCCCAAGTGCAGCCCCCAAGCGCACTCCTGAGCCT

CCAGGGAGTGTGGAGAGCCAGGGCGTGTTCCCTTGCAGAGAGTGTGAGAG GGTGTTCGACAAGATCAAGAGTCGGAATGCCCACATGAAGCGCCACCGC

CTCCAGGAGCATGTGGAACCCGTTAGGGTGAAGTGGCCTGTGAAGCCCTACCCACTGAAGGAGGAAGAGGAGGAGGAAGAAGAGGAGCTGGGGGCCGACA

TGGGCCCCTTGCAGTGGTGACTTCTTGCTAGAATTTGGTCTGCAAGGAGAGGGGAATTCAGCTCTGAACCAGTGCCCTGGGCCTCTCAGAAGTGTTTGGG

GCCCTCTTATCCTCTCTGTCCTCTCACTTCCAGCCTTGCTAGCATTTGGACATGAACAGGCAGAAGCCCTCCAGGTAGCTCTGCAGTCATGTGGGTCATC

AGAAGCTCCATTATCTCCTGGTTAATAGTTGCTTACTTGCCGTCCCAGTCACTTGGAGGGGACCCTGGGAGGCAGAAGGTTTGGTCTAAGTGGCATTTAG

ATCTGAGCTGGCATGGGACTGACATTGGTTAGAAAGAATCAGTAAGGACACCTGAGACACAGTGAGCTGGGCCCTCCTTGGGCAGGGCCTCTCTGCATTC

CCACCATCCCTAGTCTTGCAAAGACTGTATATTGTTAGGTGTATTTTTTACGTGTCTGCTTATATCTTATTAAATTGGGTTCTTAAAGA
Translation
MEPYSLGEEGALPSEGHLPSFSESQVLNCSDTLNRDLGPSTRDLLYAGLSGLDLDPSLSTSDMPSEVLEDNLDTLSLYSGKDSDSVKLLEEYADSESQTS

LQD DLGLGALKVPKEADEGGRATGSTRKGKRQHSSPQNPLLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKVCSKAFKRQDHL LTGHMLTHQKTKPF

VCIEQGCSKSYCDYRSLRRHYEVQHGVCILKETPPEEEAYGDPTHNHDVANQPPPSGLRSLGPPEARSPGSVLPNRDLLRCIVSSIVHQKIPSPGPAVGP

SDTEARSSACACPTSLGSSSCTPASTPVALGTLGSEIPEETHPPRKEAATEVFTPVQSRAAENGVPDPPESELESESPRLQRPSSLEGWPEGSSLPACLP

LFRGHSVPSGSQPSSHNFQWLRNLPGCPKNKGSNVFMVHKPPAVASREGSEGGGSGPSSTPTSVEPSPSLGTTQEELLPFPPALLKAPGEASSEVRQAAG

EDETWAPKKCKPDCESFPWQSPTELGLQDAQNPGGLPSDATPLFRQLFMKSQESLVSHEQMQVLQMIAKSQRIFSHTQVATASAQRPGPEGKQSTLKPLQ

GPWPPQTLPPAPTVDSFQIGPGHSEPEGSPVRRRKTMPAVSRETSPGGPRRDTKGGPKVASAPPSLTGPGLLPSRNPDSSSLAKGTLDLGDIIPNAGSRQ

SQLGGDEPAGTQLVGKQGQGENGLASGAMRGEKGPACPRGGGYRLFSGHPRAQRFSGFRKEKVKMDVCCAASPSQVAMASFSSAGPLADPPRDMKSKLTI

FNRIQ GGNIYRLPHPVKEESLAGGC CHQPNGGPTDWMESKSTFVCKNCSQMFYTEKGLSSHMCFHSDQWPSPRGKQEQQVKGQMVASV KRKAGREEG

AVEDMKRHYDCS SSSEPQDVTILSMLVSSGSCG VTPVVLSSLLQGQEKDGEERDSKESCQYRKRKKRPQPKALFAPPAPSALGEPGPGGCHQSCLHSP

VFLVDHLLKGLFQCSPYTPPPMLSPIREGSGLYFNTLCSTSRAGPHLISPVLD - UNI20168 - DQVDSSFGICVVKDDTKISIEP PHINVGSRFQ

AEIPELQERLLARVDENVASLVWKPWGDVMTNPETQDRV VMELCNVACSSVMPGGGTNLELALHCLHDAQGSVQ VALETLLLRGPQKPRTHPLADYRY

TG GSDIWTPMEKRLFKKAFCAHKKDFYLIHKM IQTKSVAQCVEYYYIWKKMVKFDCGRAPGLEKRGRRELDEVERTEDK VTCSPRERPTHRPTPELK

IKTKSYRRESILHSSPSAAPKRTPEPPGSVESQGVFPCRECER RVFDKIKSRNAHMKRHRLQEHVEPVRVKWPVKPYPLKEEEEEEEEELGADMGPLQW


For any suggestions or comments, please send an email to unitrap@crg.es