Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078862 (OTTMUSG00000016327)
Chromosomal location
Chr 2: 177670698 - 177692056 (-)
Description
predicted gene, OTTMUSG00000016327 Gene [Source:MGI Symbol;Acc:MGI:3709298]
UniGene
Mm.447424 Mm.460467 
MGI
MGI:3709298 
Uniprot/SPTREMBL
A2BFG4 A2BFG5 Q8CFP2 Q569M1 
Human Ortholog
not available
Omim not available
UniTrap UNI1239
Vector Insertion
Chr 2: 177691912 - 177691994
Public Clones DD0952 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32668
Vector Insertion
Chr 2: 177688386 - 177691945
Public Clones IST13234D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31672
Vector Insertion
Chr 2: 177683141 - 177688442
Public Clones (ggtc) IST14388D2 (tigm) IST12144C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108932
Sequence
GGAGTTTCTATGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI1239 - - UNI3

1672 - - UNI32668 - TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI31672 - - UNI32668 

- GATTTAGTCACCTATGATGATGTGCAGGTGAACTTCACTCGGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCT

AGAGACCTATAGGAATCTCACAGCTATAG - UNI31672 - GTTACATTTGGGAAGAACATACAATTGAAGACCATTTTCAAACTTCTAGAAGTCATG

GAAG CAACAAGAAAACCCACTGATGCTCCAAAACAATACTTGGGTGGAGCCATCTCCTATCTCTCAACATGCTCTATCTGGAAGGAAAGGAAGTTCCTT

CACATCTCCCCAGGATACATTTAACAACAAACACCCCATTAAGAACTTGCTGTAATCATTGTCCAGGGTCAGTGCCTTGGGTAGTTGACACATGAGAAGC

TCCTGTGACATCTTGTGAACTGTCACTGCCATGGAGCCAGGAACCCACCTCAGTGTTGGGACATCATTGCTGGTGCTAATGTACAGACTTCAAGAATGTG

CCTGTCTAAGATGAAAAGTGGATGGAGGAAGGACAAGGGCAAAAGTGACAGAGTTTGTTCAAAGAAAAACAAAGCAGGGGCTTCTCAAAAAGCTAGCTTG

CCATTCCCCCATCACCCTCAACTCTCCCATTCCCTGAGAATCCCACAAGTCAGGAAGGTTTCGGTGGCCCTCTTGTGGCGACCTCAAATATTGCTCAATG

TTTTTTGGTTGCATCATGCAAGTGGTACCAGCTAGAAACAAGGTGTGAAATAAAACTATTTTAAAGGTT
Translation
 - UNI1239 - - UNI31672 - - UNI32668 - M - UNI31672 - - UNI32668 - DLVTYDDVQVNFTRDEWALLDPSQKSLYKGVML

ETYRNLTAIG - UNI31672 - GYIWEEHTIEDHFQTSRSHGS SNKKTH
Transcript ENSMUST00000108931
Sequence
AGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTATGTGATGTGTTCTGCGTGACTCTACTG

GGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI1239 - - UNI31672 - - UNI32668 - TGTCTTCGCTGGATGCT

GTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI31672 - - UNI32668 - GATTTAGTCACCTATGATGATGTGCAGGTGAACTT

CACTCGGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI31

672 - GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATT

AAACATAATGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGA

AACCCTATGACTGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAATCGAACACATGCAGGAGAGAAACAGTATGAATGTAA

CCAATGTGGTAAAGCTTTTAAAAGAAGGA TGGCCTCCAAATATATAA
Translation
 - UNI1239 - - UNI31672 - - UNI32668 - M - UNI31672 - - UNI32668 - DLVTYDDVQVNFTRDEWALLDPSQKSLYKGVML

ETYRNLTAIG - UNI31672 - GMKEVVLQSNPLSLFNVVKPLHMRVVDKGIKLNIMERNTMTVTNVVRTLEHGMSCKYISEHIQERNPMTVNNVVKP

LQEAVISEYIIEHMQERNSMNVTNVVKLLKEG WPPNI
Transcript ENSMUST00000108930
Sequence
AGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTATGTGATGTGTTCTGCGTGACTCTACTG

GGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI1239 - - UNI31672 - - UNI32668 - TGTCTTCGCTGGATGCT

GTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI31672 - - UNI32668 - GATTTAGTCACCTATGATGATGTGCAGGTGAACTT

CACTCGGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI31

672 - GTTACATTTGGGAAGAACATACAATTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTGCAGAGCAACCCT

CTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTAACCAATG

TGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGCCTTTGCA

AGAAGCTGTCATCTCCGAATACATAATCGAACACATGCAGGAGAGAAACAGTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCC

AAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGTAAGCAGTGGTGACCTCCAAAAACATAAACGAAC

ACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTTCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAA

CCCTATGAATGGAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGACCTCCAAAAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAAC

AATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACATACATGAGCGAAGACATACAGGAGACAAACCCTATGAATGTAAACAATGTGGTAAAGCCTT

TGCAGTATTCTATACTCTCCAAATGCATAAGCGAACACATACAGGAGACAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTACAGTAATCTATACT

CTCCAAATGCATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTTCACAAAGCAGACATCTCCGAATACATAAGC

GAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAGAAGTGGTGACCAACAAGAACATAAGCGAACACATACAGGAGA

GAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAAGAAGGAGAGTCCTCCAAATACATAAGCGAACACATACAGGAGAGAAATCATATGAATGT

AAACAATGTGGTAAAGCCTTTGCAGGAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAG

CTTTTATAACAAGGAGAGTCCTCCAAATACATAAGCGAACACATACCGGAGAGAAATCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAG

TGACCTCCAAAAACATAAACGGACACATTCCGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACAT

AAGCAAACACATACAGGAGAGAGACCCTATGAATGTAACTAG
Translation
 - UNI1239 - - UNI31672 - - UNI32668 - M - UNI31672 - - UNI32668 - DLVTYDDVQVNFTRDEWALLDPSQKSLYKGVML

ETYRNLTAIG - UNI31672 - GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNV

LQIHKRTHTGEKPYDCKQCGKAFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRSDLQIHKRTHTGEKPYECNQCGKAFVSSGDLQKHKRTHTGEKPYEC

KQCGKAFSQSSHLRIHKRTHTGEKPYEWNQCGKAFARSGDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHIHERRHTGDKPYECKQCGKAFAVFYTLQMH

KRTHTGDKPYECKQCGKAFTVIYTLQMHKQTHTGEKPYECKQCGKAFSQSRHLRIHKRTHTGEKPYECNQCGKAFARSGDQQEHKRTHTGEKPYECNQCG

KAFIRRRVLQIHKRTHTGEKSYECKQCGKAFAGSSHLRIHKRTHTGEKPYECNQCGKAFITRRVLQIHKRTHTGEKSYECKQCGKAFASSSDLQKHKRTH

SGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN
Transcript ENSMUST00000108929
Sequence
ATGAAACCAAAATTTAAAACAATTCATACAGATAAAAAGACTCATCAGTATAATCAGTGTAAGAAAGATTTCACGTGTGCAAATTTTATTTGCAGGCATG

AAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATAATGG

AGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAC

TGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAATCGAACACATGCAGGAGAGAAACAGTATGAATGTAACCAATGTGGTA

AAGCTTTTAAAAGAAGGAGTGACCTCCAAATACATAAGCGAACACATACAG GAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAGAA

GTGGTGACCAACAAGAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAAGAAG GAGAGTCCTCCAAA

TACATAAGCGAACACATACCGGAGAGAAATCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAGTGACCTCCAAAAACATAAACGGACACA

TTCCGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAGAGACCC

TATGAATGTAACTAG
Translation
MKPKFKTIHTDKKTHQYNQCKKDFTCANFICRHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYD

CKQCGKAFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRSDLQIHKRTHTG GEKPYECNQCGKAFARSGDQQEHKRTHTGEKPYECNQCGKAFIRR RR

VLQIHKRTHTGEKSYECKQCGKAFASSSDLQKHKRTHSGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN
Transcript ENSMUST00000099000
Sequence
AGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTATGTGATGTGTTCTGCGTGACTCTACTG

GGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI1239 - - UNI31672 - - UNI32668 - TGTCTTCGCTGGATGCT

GTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI31672 - - UNI32668 - GATTTAGTCACCTATGATGATGTGCAGGTGAACTT

CACTCGGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI31

672 - GTTACATTTGGGAAGAACATACAATTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAG AT ATAAAAAGACTCAT
Translation
 - UNI1239 - - UNI31672 - - UNI32668 - M - UNI31672 - - UNI32668 - DLVTYDDVQVNFTRDEWALLDPSQKSLYKGVML

ETYRNLTAIG - UNI31672 - GYIWEEHTIEDHFQTSRSHGR RY YKKTH
Transcript ENSMUST00000108928
Sequence
GAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI1239 - - UNI31672 - - UNI32668 - TGTCTTCGCTGGATGCTGTGAATTTAGCT

CAAGCAAGCTCAGAACTTCACACATG - UNI31672 - - UNI32668 - GATTTAGTCACCTATGATGATGTGCAGGTGAACTTCACTCGGGATGA

GTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG - UNI31672 - GTTACA

TTTGGGAAGAACATACAATTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAGGTAATTTTCCTCTGCAAGCTGATGAGAAAATGCCTATGAAGAAAG

TTTAACTCGTGGTACAAGTAGTAAAGAAAACCAATAGGGTACAATAAGCACTGCTTTCAGTTATGGATGTTTATTGAATTTCATAAAATCATATATGTCT

ATGGCAGATATGTAATTATTGTTTGCAAGACTTTCCATTAGTTCAAAAACAGAGAAATAATGGCTTAACACATATGTTACTGTTTAAATCAAGCCTAGTA

GAGCCATGCTGTACAAGGGCGAGTCTCTTCAGTCTCATATCGCTTAGCTATTGCAAAAGGAACACACAGTGATTAGGTGACAAGTATATGTCTAAAACCT

AGTAATAAGCAAATAATCCATAGTATATCTGAGCTCAATGATATACTTGTAATAACATTGCTAAATTTAGTGAGATGGACAGTTCATAAGATTCAAGAAT

GGTTTTGTGGTAAAGCCTTAACTCTGTACCACATCTCTGTGGTGAAA
Translation
 - UNI1239 - - UNI31672 - - UNI32668 - M - UNI31672 - - UNI32668 - DLVTYDDVQVNFTRDEWALLDPSQKSLYKGVML

ETYRNLTAIG - UNI31672 - GYIWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es