Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078863 (OTTMUSG00000016325)
Chromosomal location
Chr 2: 177564276 - 177575023 (-)
Description
predicted gene, OTTMUSG00000016325 Gene [Source:MGI Symbol;Acc:MGI:3702875]
UniGene
Mm.354356 Mm.448539 Mm.466160 
MGI
MGI:3702875 
Uniprot/SPTREMBL
Q569M0 A2AW67 Q2TBY2 
Human Ortholog
not available
Omim not available
UniTrap UNI6522
Vector Insertion
Chr 2: 177569352 - 177574941
Public Clones (sanger) CSC166 (baygenomics) 5SE031C01 (ggtc) IST13600F10 (tigm)
IST12687H12 (tigm) IST13572E3 (tigm) IST14889E10 (tigm)
Private Clones OST462911 (lexicon) OST433941 (lexicon) OST433121 (lexicon) OST351200 (lexicon)
OST348609 (lexicon) OST339184 (lexicon) OST332123 (lexicon) OST327169 (lexicon)
OST306527 (lexicon) OST271397 (lexicon) OST269631 (lexicon) OST261568 (lexicon)
OST209023 (lexicon) OST206884 (lexicon) OST195118 (lexicon) OST183359 (lexicon)
OST114393 (lexicon) OST42137 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6524
Vector Insertion
Chr 2: 177569017 - 177569224
Public Clones CSC168 (baygenomics) W052F04 (ggtc) W088A02 (ggtc)
Private Clones OST193243 (lexicon) OST99188 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35834
Vector Insertion
Chr 2: 177564275 - 177567802
Public Clones IST14111G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108940
Sequence
GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI6522 - GATTTAATCACCTATGATGACGTG

CATGTGAACTTTACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTA

TAG - UNI6524 - GTTACATTTGGGAAGAACATACAATTGAAGACCATCTTCAAACTTCTAGAAGTCATGGAAG - UNI35834 - GCATGAAAG

AAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATACTGGAGAG

AAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTA

AACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAATCGAACACATGCAGGAGAGAAACAGTATGAATGTAACCAATGTGGTAAAGC

TTTTAAAAGAAGGAGTGACCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGAAAAGCCTTTGTAAGCAGTGGT

GAACTCCAAAAACATAAACGAACACATACAG - UNI35834 - GAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAGAAGTGGTGA

CCAACAAGAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAAGAAGGAGAGTCCTCCAAATACATAAG

CGAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAGTGACCTCCAAAAACATAAACGGACACATTCCGGAG

AGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAGAGACCCTATGAATG

TAACTAG
Translation
VLRDSTGCCERRLVKLRTPNM - UNI6522 - DLITYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG - UNI6524 - GYIWEEHTIE

DHLQTSRSHGR - UNI35834 - RHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHTGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGK

AFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRSDLQIHKRTHTGEKPYECKQCGKAFVSSGELQKHKRTHTG - UNI35834 - GEKPYECNQCGKA

FARSGDQQEHKRTHTGEKPYECNQCGKAFIRRRVLQIHKRTHTGEKPYECKQCGKAFASSSDLQKHKRTHSGEKPYECKQCGKAFAQSSHLRIHKQTHTG

ERPYECN
Transcript ENSMUST00000108939
Sequence
GAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI6522 - GATTT

AATCACCTATGATGACGTGCATGTGAACTTTACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACC

TATAGGAATCTCACAGCTATAG - UNI6524 - GTTACATTTGGGAAGAACATACAATTGAAGACCATCTTCAAACTTCTAGAAGTCATGGAAG - U

NI35834 - GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCA

AATTAAACATACTGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGA

GAGAAACCCTATGACTGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAATCGAACACATGCAGGAGAGAAACAGTATGAAT

GTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGAAA

AGCCTTTGTAAGCAGTGGTGAACTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTTCACAAAGC

AGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGACCTCCAAAAAC

ATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACATACATGAGCGAAGACATAC

AGGAGACAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTATTCTATACTCTCCAAATGCATAAGCGAACACATACAGGAGACAAACCCTAT

GAATGTAAACAATGTGGTAAAGCCTTTACAGTAATCTATACTCTCCAAATGCATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTG

GTAAAACCTTTTCACAAAGCAGACATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAG

AAGTGGTGACCAACAAGAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAAGAAGGAGAGTCCTCCAA

ATACATAAGCGAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAGTGACCTCCAAAAACATAAACGGACAC

ATTCCGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAGAGACC

CTATGAATGTAACTAGTATGGTAAAGCCTTTGCAGGAAGCAGTGGTCTCCAATGCCATAAAAGATAAATACAGGAGAGACACCATATGAATGTAACCAAG

GTGGTAAACCCTTTGAAGGAAGCAGTGGTCTTGAATATTATAATCGAACACACACAGCTGAAAAACCCAGGAATGTAACCAATGTGGTAAAGTCTTTGCA

GGAAGGAGTGACCTTTAAAGAGAAAAGACCATACAGGAGAGAAACTCTATATAGGTATCTGATGTTATAAAGCCTTTGCAGCAAGCATTGATCTCCAAGT

ACATAAATGAACATATACCAGAGAGGAACCTTTTAAACGTAACCAATGTGGTAAAGCTTTTTCGAAAACCAATAGTCTTTACACACATAAAAGCACATAT

AGTTGAGAGAAATGCTTTGATTTTAACCAATGTGGTTAAACTTTTTCAAAAAGCAGTCATCAACAAAATCATGAAAGAGCACGTATAGGAGAGAGATTTT

TGAATGTTAGCAATGGTGCTTTTATAGCTTTTTCACAAAGCAGTGGCCTCCAAATATATAAAGGAACACATACAGGAGAGAAACCCCATGAATATTGGCA

ATGTTTTAAAGGACTTCTACAGCACAATCATCTTCAAATCTGTAAGGAACATGAGGTTTTGAGAAATCCTCTGAATAACACCAATTAGGGAAAGCAATTG

TACAAAAGAGTCATCTCCCAACACAAAAGTATACACACTAGATAGAAACCCTATGAATATAGGCAATGTGGTAAACATTTTATAAGTCACAGTAGTCTGT

AAGAAAAGGAGACACAGTTGAGAAAAACACTATGAAATGAACAAGTGAACAGAGCCTTGTGCATTAAAATCTTCAAATACATAAAAGAAGACATAGAGGT

GAGAAACCCGATGTCTACAAGCCATGTGGTATTGCTTTCACTTGTCAGTCATATTCAAAGACACAAAAGAAAACAAAATGTAGCAAAAGGCTGAGTGTGT

TTAATATGGTGAAACTTTTTGAATATTTTAGAGTCTTTACAATGAAACAATTCATACTGCAAATAAATTTAGGAATATAATATGGTGAAACCTTATCAGA

TTTCCCAAATCTTCATCATTATGAATGAGAAACCCATAAATGCATTCAATATGGGGAAGCCTTTTAACATTTCTAATTCTTTATAATCCTGAAAATAATC

ATACAAAGGAGTTCAAGGGGATACAAGAAATGTTTCTTATTGTCTTGCTTGAGTTACAGTCCTGACATCCTTTGGTATGAATATCAATGTGGAAATTGTG

AGCTGGATTAAACCCTTTCCTCCCCAACTGCTTCTTGGTCATGATGTTTATGCAGGAATAGAAACCCTGAGTAAGACAAATTGGTATCAGAAGTGGGGTA

TTCCTGTGACAACCTGACCATGTTTTGGGAGGACTGTGGAAGGACTTTGGAACTTTGGGCTAGAAGATCCATTCTGTGTTAAGAACTCTGTGGGATGTTG

TGTAGGAAGATAATGTTGAGAACCGTGCAGAAGATGGAGGCCTGGCTTGTGAAATTTCAGAGGGAAAATTAAAGCCTCTTTTCAGGGCCATTGTTACTTT

GTGAAGATTCTGTGGTTCTGGTTAACTGGGGCTGAAGAATCAGCTGTGATTAACAAGATAATAGAATTTCTAGAGTGAAAACTTTGCATTACTGGGACTG

TTGATGCTGGTTAGCTGGAGCTAAGAAATTAGCAGTGATTAAGAAGAAACCAGCATCATTGAAGTGGCATCATCTGTGAAGTGTTTTCTGAGAGCACAGA

GGAAGTGTTCTAGAGATAATCAAGGTGGTACCTTGTGCTGTGGCTGGACTTGGTAGTGTGTAAGTCTTACCCTCGTGGTACTGGTTTTGAAGGCATGAAG

GGATAATGCAGATCAGCTAAGGCCCAGCACTTTGAGAGGCCATGGAAGGCCACTGGTGAAGGTGCAGACTCAGGTGAAATTGATGGCCCAGTACTGAAGA

GATCATGCAGTGTTTTGGAGTTGACAGGTCCATGAATGACCACGAAGAACAGCAGCAGCAGTAAAGTACATGCATCTGGAGCCTAGAGGACAAGTGGTGT

GCTACAAAGGACAGGGTTGGAAAAGTGACCCAAGCCCTTGGATCTTTTGGAGTTGTCCAAAAGATCGTGAGTTGGATCCCAGACATTGGACAGTTGGAGT

TTAATTTTTACTTTTGATTGTGACTGTGCCCTGATG
Translation
M - UNI6522 - DLITYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG - UNI6524 - GYIWEEHTIEDHLQTSRSHGR - UNI358

34 - RHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHTGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKAFARSCHLRIHNRTHAGEKQ

YECNQCGKAFKRRSDLQIHKRTHTGEKPYECKQCGKAFVSSGELQKHKRTHTGEKPYECKQCGKAFSQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDL

QKHKRTHTGEKPYECKQCGKAFAHSSHLHIHERRHTGDKPYECKQCGKAFAVFYTLQMHKRTHTGDKPYECKQCGKAFTVIYTLQMHKQTHTGEKPYECK

QCGKTFSQSRHLRIHKRTHTGEKPYECNQCGKAFARSGDQQEHKRTHTGEKPYECNQCGKAFIRRRVLQIHKRTHTGEKPYECKQCGKAFASSSDLQKHK

RTHSGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN
Transcript ENSMUST00000108937
Sequence
GATTTAATCACCTATGATGACGTGCATGTGAACTTTACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAG

AGACCTATAGGAATCTCACAGCTATAG - UNI6524 - GTTACATTTGGGAAGAACATACAATTGAAGACCATCTTCAAACTTCTAGAAGTCATGGAA

G - UNI35834 - GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGG

CATCAAATTAAACATACTGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATA

CAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAATCGAACACATGCAGGAGAGAAACAGTA

TGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGT

GGAAAAGCCTTTGTAAGCAGTGGTGAACTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTTCAC

AAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGACCTCCA

AAAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACATACATGAGCGAAGA

CATACAGGAGACAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTATTCTATACTCTCCAAATGCATAAGCGAACACATACAGGAGACAAAC

CCTATGAATGTAAACAATGTGGTAAAGCCTTTACAGTAATCTATACTCTCCAAATGCATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAAACA

ATGTGGTAAAACCTTTTCACAAAGCAGACATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTT

GCAAGAAGTGGTGACCAACAAGAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAAGAAGGAGAGTCC

TCCAAATACATAAGCGAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAGTGACCTCCAAAAACATAAACG

GACACATTCCGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAG

AGACCCTATGAATGTAACTAG
Translation
DLITYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG - UNI6524 - GYIWEEHTIEDHLQTSRSHGR - UNI35834 - RHERSCSAE

QPSEFIQCGKAFAYESGRQRHQIKHTGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKAFARSCHLRIHNRTHAGEKQYECNQCGKAFKRRS

DLQIHKRTHTGEKPYECKQCGKAFVSSGELQKHKRTHTGEKPYECKQCGKAFSQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQKHKRTHTGEKPYE

CKQCGKAFAHSSHLHIHERRHTGDKPYECKQCGKAFAVFYTLQMHKRTHTGDKPYECKQCGKAFTVIYTLQMHKQTHTGEKPYECKQCGKTFSQSRHLRI

HKRTHTGEKPYECNQCGKAFARSGDQQEHKRTHTGEKPYECNQCGKAFIRRRVLQIHKRTHTGEKPYECKQCGKAFASSSDLQKHKRTHSGEKPYECKQC

GKAFAQSSHLRIHKQTHTGERPYECN

For any suggestions or comments, please send an email to unitrap@crg.es