Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078864 (OTTMUSG00000016321)
Chromosomal location
Chr 2: 177493998 - 177507393 (+)
Description
predicted gene, OTTMUSG00000016321 Gene [Source:MGI Symbol;Acc:MGI:3652185]
UniGene
Mm.403392 
MGI
MGI:3652185 
Uniprot/SPTREMBL
A2ARR5 A2AW66 
Human Ortholog
not available
Omim not available
UniTrap UNI3415
Vector Insertion
Chr 2: 177497606 - 177502748
Public Clones AB0244 (sanger) (sanger) RRU200 (baygenomics) 5SD074G01 (ggtc) 3SD074G01 (ggtc)
IST11571E5 (tigm) IST14641H2 (tigm) IST14697A2 (tigm) IST10461G9 (tigm)
Private Clones OST406491 (lexicon) OST373521 (lexicon) OST358509 (lexicon) OST355206 (lexicon)
OST321466 (lexicon) OST131544 (lexicon) OST40617 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38717
Vector Insertion
Chr 2: 177502876 - 177503080
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108942
Sequence
CGGGAGTTTCTGTGTGATGTGTTCTGCATGACTCTACTGGGAGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG TGTCTTCGCTGGATAC

TGTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI3415 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAG

TGGGCTTTGCTGCATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACAT

ACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTGCAGAGCAACCCCCTGAGTTTATTCAATGTGGTAAAGCC

TTTGCATATGAGAGTGGTAGACAAAGGCATCAAATAAAACATACTGGAGGGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACAAGGAATG

TCCCCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAACCAATATGGTAAAGCCTTTGCAAGAATCAGTCATCTTCGAGTACATAA

GCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATACAGGA

GAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATGCAGGAGATAAACGGTATGAAT

GTAACCAATGTGGTAAAGCCTTTACACAGAGCAATAATCTCCAAATACATAAGGGAACACATGCAGGAGAAAAACGGTATGAATGTAACCAATGTGGTAA

AGCCTTTGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAAAAGT

TGTGACCTCCAAAAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAAGCTATACTCTCCAAATCC

ATAATCGAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTAATCTCCGAATACATAAGCAAACACATAC

AGGAGAGAGACTCTATGAATGTAACTAGCTTTGCAGGAAGCAGGGGTCTCCAATGCCATAAAAGATCACATACAGGAGAGACACCATATGAATGTAACCA

AGGTGGTAAACCCTTTGAAGGAAGCAGTGGTCTTGAATATCATAATCGAAAACACACACAGCTGAAAAACCCTATGAATGTAACCAACGTGATAAAGCGT

TTGCAGGAAGGAGTGACATTTAAAGAGAAAAGACCATACAGGAGAGAAACTCTATCAAGGTATCTGATGTTATAAAGCCTTTGCAGCAAGGATTGATCTC

CAAGTACATAAATGAACACATACCAGAGAGGAACCTTTTAAATGTAACCAATGTGGTAAAGCTTTTTCGAAAAACAATAGACTTTACAAACATAAAAGCA

CATATAGTTGAGAGAAATGTTTTGATTTTAAAGAATGTGGTTAAACTTTTTCAAAAAGCAGTCATCAACAAAATCGTGAAAGAACACGTATATATAGGAG

AGAGATTTTTGAATGTTAGCAATGGTGCTTTTACACCTTTTTCACAAAGCATTGGCCTCCAAATATATAAAGAAACACATACAGGAGAGAAACCCTATGA

ATATCAGCAATGTTTTAAAGCACTTCTACATCACACTCATCTTCAAATCTGTAAAGACAATGAGGTGGAGAGAAATCCTCTGAATAACACTAATTAGGGA

AAGCAATTGTACATAAGAGTCATCTCCCAACACAAAAGTATACACACTAGATAGAAACCCTATGAATATAGGCAATGTGGTAAACATTTTATAAGTCACA

GTAGTCTCTAAGAAAATAAAAGGAGACACAGTTGAGAAAAACCCTATGAAATGAACATATGAACAAAGCCTTGTGCATTAAAATCTTCAAATACATAAAA

GAAGACATAGAGGTGAGAAACCCTATGTCTACAAGCCATGCGGTATTGCTTTCACTTGTCAGTCATATTCAAAGACACAAAAGAAAACAAAATGTAGAAA

AAAGGCTGAGTGTATTTAATATAGTGAAACTTTTTGAATATTTCTAGAGTCTTCACAATGAAACAATCCATACTGCAAAGAAATTTAGGAATATAATATG

GTAAAACCTTATCAGATTTCCCAAATCTTCATCATTATGAATGAGAAACCCATGAATGCATTCAATATGGGGAAGCCTTTAAATATTTCAAATTCTTCAT

TATCATGAAAATAATCATACAAAGGAGATCAAGGGGATACAAGGCATGTTTCTTATGGTCTTGCTTGAGTTACAGTCCTGACATCCTTTGGTGATAAATA

TCAATGTGGAAAGTGTGAGCTGGATTAAACCCTTTCCTCCCCAACTGCTTCTTGGTCATGATGTTTATGCAGGAATAGAAACCCTGACTAAGACAAATTG

GTATCAGAAGTGGGGTATTTTTGTGACAAACTGACCATGTTTTGGGAGGACGGTGGAAGGACTTTGGAACTTTGGGCTAGAAGATCCATTCTTTGTTAAG

AACTCTGTGGGATGTTGTGTAGGAGCTTGGAAGATAATGTTGAGAGCCGTGCAGAAGATGGAGGCCTGGCTTGTGAAATTTCAGAAGGAAAATTAAAGCC

TCTTTTCAGGGCCATTGTTACTTTGTGAAGATTCTGTGGTTCTAGTTAGCTGGGGCTGAAGAATCAGCTGTGATTAACAAGATACCAGAACTAGTAGAGT

GAAAACTTTGCATTACTGGGACTATTGATGATGGTTAGCTTGAGCTAAGAAATTAGCAGTGATTAAGAAGAAACCAGCATCATTGAAGTGGCATCATCTG

TGAAGTGTTTTCTGAGAGCACAGAGGAAGTGTTCTAGAGATAATCAAGGTGGTACCTTGTGCTGTGGCTGGACTTGGTAGTTTGTAAGACTTTCCCACGT

GGTGCTGGTTTTGAAGTCATGAAGGGATAATGCAGAGCAGCTAAGGCCCAGCACTTTGAGAGGCCATGGAAGGCCACTGGTGAAGGTGCAGACTCAGGTG

AAATTGATGGCCCAGTACTGAAGAGATCATGCAGTGTTTTGGAGTTGACAGGTCCATGAATGACCACGAAGAACAGCAGCAGCAGTAAAGTACAGGCATC

TGGAGCCTAGAGGACAAGCTGTGTGCTACAAAGGACAGGGTTGGAGAAGTGACCCAAGCCCTTGGAGTTGTCCAAAAGATCGTGTGAGTTGGATCTGAGA

CTTTGGACAGTTGGAGTTTAATTTTTACTTTTGATTGTGACTGT
Translation
 M - UNI3415 - DLVTYDDVHVNFTQEEWALLHPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPPEFIQCGK

AFAYESGRQRHQIKHTGGKHHDCNQCGKDFRTRNVPQIHKRTHTGEKPYDCNQYGKAFARISHLRVHKRTHTGEKPYECNQCGKAFASSSDLQKHKRTHT

GEKPYECNQCGKAFAQSSHLRIHKRTHAGDKRYECNQCGKAFTQSNNLQIHKGTHAGEKRYECNQCGKAFASSSDLQKHKRTHTGEKPYECNQCGKAFAK

SCDLQKHKRTHTGEKPYECKQCGKAFAVSYTLQIHNRTHTGEKPYECKQCGKAFAQSSNLRIHKQTHTGERLYECN
Transcript ENSMUST00000108941
Sequence
GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGCATCCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGCTAG

AGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG GCATGAAAGA

AGTTGTTCTGCAGAGCAACCCCCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATAAAACATACTGGAGGGA

AACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACAAGGAATGTCCCCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAA

CCAATATGGTAAAGCCTTTGCAAGAATCAGTCATCTTCGAGTACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCC

TTTGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCACAAAGCAGTC

ATCTCCGAATACATAAGCGAACACATGCAGGAGATAAACGGTATGAATGTAACCAATGTGGTAAAGCCTTTACACAGAGCAATAATCTCCAAATACATAA

GGGAACACATGCAGGAGAAAAACGGTATGAATGTAACCAATGTGGTAAAGCCTTTGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATACAGGA

GAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAAAAGTTGTGACCTCCAAAAACATAAGCGAACACATACAGGAGAGAAACCCTATGAAT

GTAAACAATGTGGTAAAGCCTTTGCAGTAAGCTATACTCTCCAAATCCATAATCGAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAA

AGCCTTTGCACAAAGCAGTAATCTCCGAATACATAAGCAAACACATACAGGAGAGAGACTCTATGAATGTAACTAG
Translation
DLVTYDDVHVNFTQEEWALLHPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPPEFIQCGKAFAYESGRQRHQIKH

TGGKHHDCNQCGKDFRTRNVPQIHKRTHTGEKPYDCNQYGKAFARISHLRVHKRTHTGEKPYECNQCGKAFASSSDLQKHKRTHTGEKPYECNQCGKAFA

QSSHLRIHKRTHAGDKRYECNQCGKAFTQSNNLQIHKGTHAGEKRYECNQCGKAFASSSDLQKHKRTHTGEKPYECNQCGKAFAKSCDLQKHKRTHTGEK

PYECKQCGKAFAVSYTLQIHNRTHTGEKPYECKQCGKAFAQSSNLRIHKQTHTGERLYECN

For any suggestions or comments, please send an email to unitrap@crg.es