Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078865 (OTTMUSG00000016574)
Chromosomal location
Chr 2: 177353909 - 177362915 (-)
predicted gene, OTTMUSG00000016574 Gene [Source:MGI Symbol;Acc:MGI:3649838]
Human Ortholog
not available
Omim not available
UniTrap UNI10416
Vector Insertion
Chr 2: 177362834 - 177362905
Public Clones D067H04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34981
Vector Insertion
Chr 2: 177359673 - 177362905
Public Clones PST17296-NL (escells) IST15016D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30717
Vector Insertion
Chr 2: 177356391 - 177359729
Public Clones (sanger) IST10125D8BBR1 (tigm) IST10453E10 (tigm) IST11200G4 (tigm)
IST14983E6 (tigm) IST10940E6 (tigm) IST12574D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27356
Vector Insertion
Chr 2: 177356200 - 177356391
Public Clones not available
Private Clones OST62130 (lexicon) OST55266 (lexicon) OST53631 (lexicon) OST49484 (lexicon)
OST46355 (lexicon) OST44720 (lexicon) OST43773 (lexicon) OST43651 (lexicon)
OST42798 (lexicon) OST42796 (lexicon) OST42775 (lexicon) OST42570 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27925
Vector Insertion
Chr 2: 177356138 - 177356200
Public Clones not available
Private Clones OST43765 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23911
Vector Insertion
Chr 2: 177353908 - 177354999
Public Clones not available
Private Clones OST240638 (lexicon) OST172919 (lexicon) OST65825 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108945



















Transcript ENSMUST00000108944

















Transcript ENSMUST00000108943






 - UNI10416 - - UNI30717 - - UNI34981 - M - UNI30717 - - UNI34981 - NLITYDDVHVNFTQEEWALLDPSHKNLYKDVM


For any suggestions or comments, please send an email to