Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078868 (OTTMUSG00000016580)
Chromosomal location
Chr 2: 177096237 - 177109073 (-)
Description
predicted gene, OTTMUSG00000016580 Gene [Source:MGI Symbol;Acc:MGI:3652251]
MGI
MGI:3652251 
Uniprot/SPTREMBL
A2ARR7 
Human Ortholog
not available
Omim not available
UniTrap UNI14331
Vector Insertion
Chr 2: 177102036 - 177109074
Public Clones (sanger) 3SD115G08 (ggtc) 5SD179B02 (ggtc) 3SD101B08 (ggtc) 5SD060H06 (ggtc)
5SD115G08 (ggtc) 3SD060H06 (ggtc) FHCRC-GT-S19-10H1 (fhcrc) IST11528D1 (tigm)
IST11262D4 (tigm) IST14469B12 (tigm) IST11083A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35769
Vector Insertion
Chr 2: 177101768 - 177102164
Public Clones IST14792B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108959
Sequence
TGTGTTTTGAGCGCCTCTACTGAGTGATGTGAGGGGATGTCCCAAGCTCAGAACTCCAGACATG - UNI14331 - - UNI35769 - GATTTAGTC

ACCTATGATGATGTGCAGGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGATGTGATGCTAGAGACCCATA

GAAATCTCACAGCTATAG - UNI14331 - - UNI35769 - GTTACATTTGGGAAGAACATACAATTGAAGACCATTTTCAAACTTCTAGAAGTCA

TGGAAG - UNI35769 - GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTCATTCAATGTGGTAAAGCCTTTGCATATGAGAGTCATAGTC

AAAGGTATGAAATAAAACATACTGGAGAGAAACACCATGACTGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGATGACCTCCAAAAACATAAACGAAC

ACATACAGGAGAGAAACCCTACAAATGTAACCAATGTGGTAAATCCTTTGCAAGAAGTGGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAA

CCCTATGAATGTAATCAATGTGGAAAAGCCTTTGCAAGAAACTGTGACCTCCAAAAACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAATC

AATGTGGAAAAGCCTTTGCAAGAAAATGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTT

TGCAGAAAGCAGTACTCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGTAGTGAC

CTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAGTGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAAGC

GAACACATACAGGAGAGAAACCCTATGAATGTAATCAATGTGGTAAAGCTTTTAAAAGAAGTTGTGAACTCCAAAAACATAAGCGAACACATACAGGAGA

GAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGTTGTGAACTCCAAAAACATAAACGAATACATACAGGAGAGAAACCCTACAAATGT

AACCAATGTGGTAAAGCCTTTACACAGAGCAGTCATCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAATCAATGTGGAAAAG

CCTTTGCAAGAAACTGTGACCTCCAAAAACATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAATCAATGTGGAAAAGCCTTTGCAAGAAAATG

TGACCTCCAAAATCATAAACAAAAACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACAT

AAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAGTACATAAGCGAACACATACAG

GAGAGAAACCCTATAAATGTAAACAATGTGGTAAAGCTTTTGCAAGAAGTGGTGGCCTCCAAAAACATAAACGAACACATACAGGAGAGAGACCCAATGA

ATGTAACTAGTGTGGTAAAGCCTTTGCAGGAAACAGTGGTCTCCAATGTCACAAAAGATCACATACAGGAGAGACACCATATGAATGTAACCAATGTGGT

AAAGCCTTTGCAGGAAGGAGTGACCTTTAAAGAGAAAGGACCATACAGGAGAGAAACTCTATGAAGGTATTTAATGTTATAAAGCCTTTGCAGCAAGCAT

TGACCTCCAAGTACATAAATGAACATATACCAAGAGGAACCATTTAAATGTACCCAGTGTGGTAAAGCTTTTTCGAAAACCAATAGTCTTTACACACATA

AAAGCACATATAGTTGAGAGAAATGCTTTGATTTTAACCAATGTGGTTAAACTTTTTCAAAAAGCAGTCATCAACAAAATGAAAGAACACATATAGGAGA

GAGATTTTTGAATGTTAGCAATGGTGCTTTTACACCTTTTTCACAAAGCAGTGGCCTCCAAATATATAAAGGGATAAGTACAGGAGAGAAACCCTATGAA

TATTGGCAATGTTTTAAAGCACTTCTACAGCACAATCATCTTCAAATCCATAAAGTACATGAGGTGGAGAGAAATCCTCTGAATAACACTATTTAGGGAA

ATCAATTGTACAAAAGAGTCATCTCCCAACACAAAAGTATACACACTGGATAGAAACACTATGAATATAAGCAGTGTGGTAAACATTTTTTTAAATTTTA

TTTTATTTTTATTAGGTATTTTCCTCGTTTATATTTTCAATGCTATCCCAAAAGTCCGCCATACCCACCCCCCCCCAATCCACTACCCACCCACTCCCCC

GTTTTGGCCCTGGGATTCCCCTTGTGGTAAACATTTTATAAATCACAGTAGTCCTTAAGTAAATAAAAGGAGACACAGTTGAGAGAAACCCTATGAAAGT

TATCAAATGAACAAAGCCTTGTACATTAAATACTTCAAATACATAAAAGAAGACATAGAGGTGAGAAACTCTATGTTTGCAAGCCATGTGGTATTGCTTT

TATTTCTCAGTCATATTCAAAGACACAAAAGAAAATATAATGTAGACAAAATGCTGCGTGTATTTAACATGGTGAAGATTTTTGAATATTTCTAGAGTCT

TCACAATCAAACAATCCATACTGCAAAGAAATTTAGGAATATAATATGGTGAAACCTTTTCAGATTTCCCAAATCTTCATCATTATGAAAGAGAAACCCA

TGAATGCATTCAATATGGGGAGGCCTTTAAACATTTCTAATTCATCATCATCATGAGAATAATCATACAAAGGAGATCAAGGGGATACAAGGCATGATTC

TTATTGTCTTGCTTGAGTTACAGTCCTGACAATCTTTGGAGATAAATATCAATGTGGAAAGTGTAAGCTGGATTAAACCCTTTCCTCCCCAACTGCTTCT

TGGTCATGATGTTTATGCAGGAATAGAAACTATGACTAAGACATATTGGTATGAGGAGTGGGGTATTCCTGTGAAAACCTGACCATGTTTTGGGAGGACT

GTGGAAGGACTTTGGAACTTTGGGCTAGAAGATCCATTCTGTGTTAAGAACTCTGTGGGATGTTGTGTAGGAGTTTGGAAGATAATGTTGAGAACAGTGC

AGAAGATGAAGGCCTGGCTTATGAAATTTCACAGGAAAAATTAAAGACGCTTTTGAGGTCCATTGCTATTTTGGATTGTGAAGATTCTGTGGTTCTGGTT

AGCTAGGTCTGAAGAATCAGCTGTGATGAACAAGATACCAGAATTTCTAGAGTGAAAACTTTGCTTTACTGGGACTATTGATGCTGGTTAGCTGGAGCTG

AGAAATTAGCAGTGATTAAGAAGAAACCAGCATCATTGAGGACCATCATCTGGGAAGTGTTTTCTGAGAGCACAGAGGCAGTGTTATATAGTCAAGTTTG

TACCTTGTGCTATGCCTGGACTTGGTAATGTGTTACAGTTACCCACATGGTACTGGTTTTGAAAGCATGAAGGGATAATGCAGAGCAGCTGATGCCCTGC

CATTTGAGAGGTCATGGAAGGCCATTGGTGAAGGTGCAAACTCAGGTAAAATTGATGTCCCAGTACTGAAGAGATGATGTAGTGTTTTGGAGTCACTAGG

TCCATGAATGACCAATAACAGCAGCAACAATAAAGTACAGGCTTCTGGAGCCTAGAGGACAATCTGTGTGCTACAAAGGACAGGGCTGGAGAAGTGACCC

AAGCCCTTGGAGGAGCCCAAAAGATCGTGAGTTTGATCCCAGACATTGGACAGTTGGAGTTTAATTTTTGCTTTTGATTGTGACTGTACACTAATATTTT

TCCCTCTTGAAGGGAGAAATTATTTTAGTGGATTCCATAGTTAATAGACTTTTAATTGTAAAAGGCTTTGGATTTTAAAGGATATTGGATATTTTAAAAG

ATTTAACTTTTACTATGTAAAGATTGTGGGGCTTTCAAAGTTGCTTAGAACTTAGGGATGAATAAGAAACTAAGGGTTGAGGCTTAGTTGTGATGTGTTT

GTGTGTCAAGTTGACAAGGGGTCAATTGTAGTGGCTAGTTTTGTGTCAAGTTGACACAAGCTGGAGTTATAACAGAGAAAGGAGCTTCAGTTGGGGAAAT

GTCTCCATGAGATCCAGCTGTAAGACATTTTCTCATTTTGTGATCAAGGGGAAAGGCCCCTTGTGGGGACCATCTCTCTGGGCTGGTAGTCTTGGGTTCT

CTAAGAGAGCAGTCTGAGCAAGACAGGGGAAGCAAGCCAGTAAAGAAACATCCCTCCATGACCTCTGCATCGGCTCCTGCCTCTTGACCTGCTTGAGTTC

CAGTCCTGACTTCCTTGGTGATGAACAGCAAGCAGTATGAAAGTATAAGCCGAATAAACTCTTCTCCCTCCCCCCAACTTGCTTCTTGGTCATGATGTTT

GTGCAGGAATAGAAACCCTGAATAAGAAAAGGTGTATAAAGTTGGATTGTAAAAAAAGAGATTATACAATAAAGAAATGAAGAAGTAAAAATATTTTA
Translation
M - UNI14331 - - UNI35769 - DLVTYDDVQVNFTQEEWALLDPSQKSLYKDVMLETHRNLTAIG - UNI14331 - - UNI35769 - GY

IWEEHTIEDHFQTSRSHGR - UNI35769 - RHERSCSAEQPSEFIQCGKAFAYESHSQRYEIKHTGEKHHDCNQCGKAFARSDDLQKHKRTHTGEKP

YKCNQCGKSFARSGDLQKHKRTHTGEKPYECNQCGKAFARNCDLQKHKRTHTGEKPYECNQCGKAFARKCDLQKHKRTHTGEKPYECKQCGKAFAESSTL

QIHKRTHTGEKPYECNQCGKAFKRSSDLQKHKRTHTGEKPYECKQCGKAFAESSTLQIHKRTHTGEKPYECNQCGKAFKRSCELQKHKRTHTGEKPYECN

QCGKAFKRSCELQKHKRIHTGEKPYKCNQCGKAFTQSSHLQIHKRTHTGEKPYECNQCGKAFARNCDLQKHKQTHTGEKPYECNQCGKAFARKCDLQNHK

QKHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFKRRSDLQVHKRTHTGEKPYKCKQCGKAFARSGGLQKHKRTHTGERPNECN
Transcript ENSMUST00000108957
Sequence
GATTTAGTCACCTATGATGATGTGCAGGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGATGTGATGCTAG

AGACCCATAGAAATCTCACAGCTATAG - UNI14331 - - UNI35769 - GTTACATTTGGGAAGAACATACAATTGAAGACCATTTTCAAACTTC

TAGAAGTCATGGAAG - UNI35769 - GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTCATTCAATGTGGTAAAGCCTTTGCATATGAGA

GTCATAGTCAAAGGTATGAAATAAAACATACTGGAGAGAAACACCATGACTGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGATGACCTCCAAAAACA

TAAACGAACACATACAGGAGAGAAACCCTACAAATGTAACCAATGTGGTAAATCCTTTGCAAGAAGTGGTGACCTCCAAAAACATAAACGAACACATACA

GGAGAGAAACCCTATGAATGTAATCAATGTGGAAAAGCCTTTGCAAGAAACTGTGACCTCCAAAAACATAAGCGAACACATACAGGAGAGAAACCCTATG

AATGTAATCAATGTGGAAAAGCCTTTGCAAGAAAATGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGG

TAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGA

AGTAGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAGTGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAA

TCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAATCAATGTGGTAAAGCTTTTAAAAGAAGTTGTGAACTCCAAAAACATAAGCGAACACA

TACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGTTGTGAACTCCAAAAACATAAACGAATACATACAGGAGAGAAACCC

TACAAATGTAACCAATGTGGTAAAGCCTTTACACAGAGCAGTCATCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAATCAAT

GTGGAAAAGCCTTTGCAAGAAACTGTGACCTCCAAAAACATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAATCAATGTGGAAAAGCCTTTGC

AAGAAAATGTGACCTCCAAAATCATAAACAAAAACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTC

CGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAGTACATAAGCGAA

CACATACAGGAGAGAAACCCTATAAATGTAAACAATGTGGTAAAGCTTTTGCAAGAAGTGGTGGCCTCCAAAAACATAAACGAACACATACAGGAGAGAG

ACCCAATGAATGTAACTAG
Translation
DLVTYDDVQVNFTQEEWALLDPSQKSLYKDVMLETHRNLTAIG - UNI14331 - - UNI35769 - GYIWEEHTIEDHFQTSRSHGR - UNI357

69 - RHERSCSAEQPSEFIQCGKAFAYESHSQRYEIKHTGEKHHDCNQCGKAFARSDDLQKHKRTHTGEKPYKCNQCGKSFARSGDLQKHKRTHTGEKP

YECNQCGKAFARNCDLQKHKRTHTGEKPYECNQCGKAFARKCDLQKHKRTHTGEKPYECKQCGKAFAESSTLQIHKRTHTGEKPYECNQCGKAFKRSSDL

QKHKRTHTGEKPYECKQCGKAFAESSTLQIHKRTHTGEKPYECNQCGKAFKRSCELQKHKRTHTGEKPYECNQCGKAFKRSCELQKHKRIHTGEKPYKCN

QCGKAFTQSSHLQIHKRTHTGEKPYECNQCGKAFARNCDLQKHKQTHTGEKPYECNQCGKAFARKCDLQNHKQKHTGEKPYECKQCGKAFAQSSHLRIHK

RTHTGEKPYECNQCGKAFKRRSDLQVHKRTHTGEKPYKCKQCGKAFARSGGLQKHKRTHTGERPNECN

For any suggestions or comments, please send an email to unitrap@crg.es