Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078869 (OTTMUSG00000016577)
Chromosomal location
Chr 2: 177049359 - 177057028 (-)
Description
predicted gene, OTTMUSG00000016577 Gene [Source:MGI Symbol;Acc:MGI:3649811]
MGI
MGI:3649811 
Uniprot/SPTREMBL
A2ARR8 
Human Ortholog
not available
Omim not available
UniTrap UNI12387
Vector Insertion
Chr 2: 177051834 - 177056958
Public Clones M017A07 (ggtc) IST11675F3 (tigm) IST14674F10 (tigm) IST12304H3 (tigm)
IST12570D6 (tigm) IST10353B10 (tigm) IST11574A8 (tigm) IST12770C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21560
Vector Insertion
Chr 2: 177049358 - 177050314
Public Clones not available
Private Clones OST326043 (lexicon) OST288690 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108963
Sequence
ATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACAAGTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAG - U

NI21560 - GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCACTGTGGTAAAGCCTTTGCAAATGAGAGTGGTAGTCAAAGGCATCA

AATAAAACATACTGGAGAGAAACAGCATGACTGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATACATAAGCGAACACATACAGGA

GAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTTCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAAT

GTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAA

AGCCTTTGCACATAGCAGTCATCTCCACATACATGAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGGCTTTGCACGAAGT

GGTGACCTCCAAAAACATAAACAAACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTTTCAAGAAAGAGTGTCCTCCAAATAC

ATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAGCACATAC

AGGATTGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGGAAGCAGTGGTCTCCAATGCCATAAAAGATCACATACAGGAGAGACACCATAT

GAATGTAACCAAGGTGGTAAACCCTTTGAAGGAAGCAGTGGTCTTGAATATAATAATCGAACACAAACAGCTGAAAAACCCTATGAATGTAACCTATGTG

CTAAAGTTTTGCAGGAAGGAGTGACCTTTAAAGAGAAAAGACCATACAGGAGAGAGACTCTATGA
Translation
MVETYRNLTAIG GYIWEEHTSEDHFQTSRSHGR - UNI21560 - RHERSCSAEQPSEFIHCGKAFANESGSQRHQIKHTGEKQHDCNQCGKAFKRR

SDLQIHKRTHTGEKPYECKQCGKAFSQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLQIHKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTGEKPY

ECKQCGKGFARSGDLQKHKQTHTGEKPYECKQCGKAFSRKSVLQIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRAHTGLKPYECKQCGKAFAGSSGLQ

CHKRSHTGETPYECNQGGKPFEGSSGLEYNNRTQTAEKPYECNLCAKVLQEGVTFKEKRPYRRETL
Transcript ENSMUST00000108961
Sequence
GTGGAATGTGTTTTGAGCGCCTCTACTAATTGATGTAAGGGGACCTCACAAACTCAAAACTCCAGACATG - UNI12387 - ATTTAATCACCTATGA

TGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATCCTTCTCATAAAAATCTCTACAAAGATGTGATGGTAGAGACCTATAGGAATCTC

ACAGCTATAG GTTACATTTGGGAAGAACATACAAGTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAG - UNI21560 - GCATGAAAGAAGTT

GTTCTGCAGAGCAACCCTCTGAGTTTATTCACTGTGGTAAAGCCTTTGCAAATGAGAGTGGTAGTCAAAGGCATCAAATAAAACATACTGGAGAGAAACA

GCATGACTGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAA

TGTGGTAAAGCCTTTTCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTG

CACAAAGCAGTCATCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCT

CCACATACATGAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGGCTTTGCACGAAGTGGTGACCTCCAAAAACATAAACAA

ACACATACAGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTTTCAAGAAAGAGTGTCCTCCAAATACATAAACGAACACATACAGGAGAGA

AACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAGCACATACAGGATTGAAACCCTATGAATGTAA

ACAATGTGGTAAAGCCTTTGCAGGAAGCAGTGGTCTCCAATGCCATAAAAGATCACATACAGGAGAGACACCATATGAATGTAACCAAGGTGGTAAACCC

TTTGAAGGAAGCAGTGGTCTTGAATATAATAATCGAACACAAACAGCTGAAAAACCCTATGAATGTAACCTATGTGCTAAAGTTTTGCAGGAAGGAGTGA

CCTTTAAAGAGAAAAGACCATACAGGAGAGAGACTCTATGA
Translation
 - UNI12387 - MVETYRNLTAIG GYIWEEHTSEDHFQTSRSHGR - UNI21560 - RHERSCSAEQPSEFIHCGKAFANESGSQRHQIKHTGEK

QHDCNQCGKAFKRRSDLQIHKRTHTGEKPYECKQCGKAFSQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLQIHKRTHTGEKPYECKQCGKAFAHSSH

LHIHERTHTGEKPYECKQCGKGFARSGDLQKHKQTHTGEKPYECKQCGKAFSRKSVLQIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRAHTGLKPYEC

KQCGKAFAGSSGLQCHKRSHTGETPYECNQGGKPFEGSSGLEYNNRTQTAEKPYECNLCAKVLQEGVTFKEKRPYRRETL

For any suggestions or comments, please send an email to unitrap@crg.es