Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078870 (OTTMUSG00000016578)
Chromosomal location
Chr 2: 176978062 - 176991207 (-)
Description
predicted gene, OTTMUSG00000016578 Gene [Source:MGI Symbol;Acc:MGI:3709158]
RefSeq_peptide
NP_001107278.1 
MGI
MGI:3709158 
Uniprot/SPTREMBL
A2ARW1 Q8BHI0 A2BE16 
Human Ortholog
not available
Omim not available
UniTrap UNI11137
Vector Insertion
Chr 2: 176987531 - 176987587
Public Clones G051B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37686
Vector Insertion
Chr 2: 176987531 - 176991127
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36940
Vector Insertion
Chr 2: 176980406 - 176987587
Public Clones 5SD031C03 (ggtc) 3SD031C03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108965
Sequence
CCCCATGGACCTGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACGTG - UNI11137 - - UNI36940 - TGTCTTCGCT

GGATGCTGTGAATTTAGCTTAAGCAAGCTCAGAACTTCACACATG - UNI11137 - - UNI36940 - GATTTAGTCACCTATGATGACGTGCATG

TGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAAGAATCTCACAGCTATAG 

- UNI36940 - GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTGCAGAG

CAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTA

ACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGT

CTTTGCAAGAAGCTGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACAGTATAAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGT

GGCCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGTAGTGGTGAACTCCAAAAACATA

AACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTTCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGG

AGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAATAAGTGGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAA

TGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAAACAATGTGGTA

AAGCCTTTGCAGTAATCTATACTCTCCAAATGCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAAT

CTATGCTCTCCAAATGCATAAGCGAACACATACAGGAGAGAAACCCTATAAATGTAAACAATGTGGTAAAGCCTTTACACAAAGCATTCATCTCTGA
Translation
 - UNI11137 - - UNI36940 - M - UNI11137 - - UNI36940 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG -

 UNI36940 - GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPSEFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEK

PYDCKQCGKVFARSCHLRIHKRTHTGEKQYKCNQCGKAFKRRSGLQIHKRTHTGEKPYECNQCGKAFASSGELQKHKRTHTGEKPYECKQCGKAFSQSSH

LRIHKRTHTGEKPYECNQCGKAFAISGDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECKQCGKAFAVIYTLQMHKRTHTGEKPYEC

KQCGKAFAVIYALQMHKRTHTGEKPYKCKQCGKAFTQSIHL
Transcript ENSMUST00000099003
Sequence
CCCCATGGACCTGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACGTG - UNI11137 - - UNI36940 - TGTCTTCGCT

GGATGCTGTGAATTTAGCTTAAGCAAGCTCAGAACTTCACACATG - UNI11137 - - UNI36940 - GATTTAGTCACCTATGATGACGTGCATG

TGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAAGAATCTCACAGCTATAG 

- UNI36940 - GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAG AT ATAAAAAGACTCAT
Translation
 - UNI11137 - - UNI36940 - M - UNI11137 - - UNI36940 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG -

 UNI36940 - GYIWEEHTIEDHFQTSRSHGR RY YKKTH
Transcript ENSMUST00000108964
Sequence
GGGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACGTG - UNI11137 - - UN

I36940 - TGTCTTCGCTGGATGCTGTGAATTTAGCTTAAGCAAGCTCAGAACTTCACACATG - UNI11137 - - UNI36940 - GATTTAGTC

ACCTATGATGACGTGCATGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATA

AGAATCTCACAGCTATAG - UNI36940 - GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAACTTCTAGAAGTCATGGAAGGTAATTT

TACTCTGCAAGCTGAGGAGAAAATGCCTATGAAGAAAGTTTAACTTGTGGTACAAGTAGTAAAGAAAACCAATAGGGTACAATAAGCACTGCTTTCAGTG

ATGGATGTTTACTGACTTTCATAAAAATCATATATGTTTATGGCAGATATGTAACTGTTGTTTGCAAGACATTCCATTAGGTCAAAGACAGAGAAATAAT

GGCTTAACACATATGTTACTGTTTAAATCAAGCCTAGTACAGCCATGCTATACAAGTGTGAGTGTCTTCAGTCTCATATCGCTTAGCTATTGCAAAAGGA

ACACACAGTGATTAGGTGACAAGTATATGTCTAAAACCTAGTAATGAGCAAATAATCCATAGTGTATCTGAGCTCAATGATATACTTGTAATAACATTGC

TAAATTTAGTGAGATGAACAGTTCATAAGATTCAAAAATGGTTTTGTGGAAAAACCTTAATCTCTGTACCACATCTCTGTGACAAAAAAAAGTCAGCTGT

GAATGTAATGTGGAATTTTCACTTGTTATTCTTCTTTTGATGTGGATGTCATAGGTTACGATTGATACAAGCCTTGTGAT
Translation
 - UNI11137 - - UNI36940 - M - UNI11137 - - UNI36940 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG -

 UNI36940 - GYIWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es