Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078872 (OTTMUSG00000016569)
Chromosomal location
Chr 2: 176859025 - 176872052 (+)
Description
predicted gene, OTTMUSG00000016569 Gene [Source:MGI Symbol;Acc:MGI:3650075]
MGI
MGI:3650075 
Uniprot/SPTREMBL
A2ARV7 A2ARV8 
Human Ortholog
not available
Omim not available
UniTrap UNI4931
Vector Insertion
Chr 2: 176859064 - 176864960
Public Clones (sanger) AM0488 (sanger) RRO205 (baygenomics) YHA131 (baygenomics) P030H02 (ggtc)
3SH010C06 (ggtc) 3SD098H01 (ggtc) 3SD175B07 (ggtc) P017G06 (ggtc)
5SD129A09 (ggtc) 5SE284G03 (ggtc) D069E08 (ggtc) 5SH010C06 (ggtc)
5SD098H01 (ggtc) 5SD175B07 (ggtc) IST12709E6 (tigm) IST12445C7 (tigm)
IST10188G7 (tigm) IST10664C5 (tigm) IST10098H5 (tigm) IST11054G2 (tigm)
IST14234B10 (tigm) IST11597H12 (tigm) IST11519H1 (tigm) IST11583C5 (tigm)
IST11829A1 (tigm) IST14140F5 (tigm) IST10513C10 (tigm) IST13972E6 (tigm)
IST10289H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4932
Vector Insertion
Chr 2: 176865025 - 176868947
Public Clones (sanger) XR0767 (sanger) 5SD069E08 (ggtc) 3SD069E08 (ggtc) CMHD-GT_284D9-3 (cmhd)
FHCRC-GT-S23-3B1 (fhcrc) IST14525G1 (tigm) IST14571D7 (tigm) IST14765B6 (tigm)
IST14239D4 (tigm) IST14232F9 (tigm)
Private Clones OST451808 (lexicon) OST439478 (lexicon) OST429126 (lexicon) OST377578 (lexicon)
OST359565 (lexicon) OST339623 (lexicon) OST327499 (lexicon) OST316319 (lexicon)
OST310087 (lexicon) OST302975 (lexicon) OST301033 (lexicon) OST296036 (lexicon)
OST289191 (lexicon) OST286080 (lexicon) OST263177 (lexicon) OST251099 (lexicon)
OST190869 (lexicon) OST180990 (lexicon) OST174620 (lexicon) OST170365 (lexicon)
OST152940 (lexicon) OST91156 (lexicon) OST85742 (lexicon) OST74970 (lexicon)
OST51793 (lexicon) OST34811 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1338
Vector Insertion
Chr 2: 176869346 - 176871018
Public Clones DB0071 (sanger) XE225 (baygenomics) XE234 (baygenomics) RRE121 (baygenomics)
W022H06 (ggtc) IST14869D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108970
Sequence
CTGCGAGGTAGCTCAGGCAAGCTCAGAACTTCAGACATG - UNI4931 - - UNI4932 - GATTTAGTCACCTATGATGACGTGCATGTCAACTTC

ACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG GTTACATT

TGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG - UNI1338 - GCGTGAAAGAAGTTGTACTGCAGAGCAACCCTCT

GAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTTGTAGTCAAAGGCATCAAATTAAACATACTGGAGAGAAACACCATGACTGTAACCAATGTG

GTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATCCATAATCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCGTTTGCACA

AAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCGGA

ATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGTAGTGGTGACCTCCAAAAACATAAACGAACAC

ATACAGGAGAGAAACCCTATGAATGTAAACGATGTGGTAAAGCCTTTGCAAGAAGCAGTGGTCTCCAATGTCATAAAAGATCACATACAGGAGAGACACC

ATATGAATGTAAACAAGGTGATAATCCCTTTGCAGGAAGCAGTGGTCTTGAATATCATAATCAAACACATACAGCTGAAAAACCCAGGAATGTAACCAAT

GTGGTAAAGCCTTTGCAGGAAGGAATGACCTTTAAAGAGAAAAGACCATACAGGAGAGAAACTCTATGTAGGTATCTAATGTTATAAAGCCTTTGCAGCA

AGCATTGATCTCCAAGTACATAAATGAACATATACCAGAGAGGAACCTTTTAAATGTAACCAATGTGGTGAAGCTTTTTCGAAAACCAATAGTCTTTACA

CACATAAAAGCACATATAGTTGAGAGAAATGCTTTGATTTTAACCAATGTGGTTAAAAATTTTCAAATAGCAGTCATAAACAAAATCATAAAAGAACACG

TATAGGAGAGAGATTTTTGAATGCTAGCAATGGTGCCTTTACACCTTTTTCATGAAGCAGTGGCCTCCAAATATATAAAGGAACACATACAGGAGAGAAA

Translation
M - UNI4931 - - UNI4932 - DLVTYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR - UNI133

8 - RRERSCTAEQPSEFIQCGKAFAYESCSQRHQIKHTGEKHHDCNQCGKAFKRRSDLQIHNRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPY

ECKQCGKAFAQSSHLGIHKRTHTGEKPYECNQCGKAFASSGDLQKHKRTHTGEKPYECKRCGKAFARSSGLQCHKRSHTGETPYECKQGDNPFAGSSGLE

YHNQTHTAEKPRNVTNVVKPLQEGMTFKEKRPYRRETLCRYLML
Transcript ENSMUST00000108969
Sequence
TGTGTTTTGAGGGCCTCTACTGAGTGATGTGAGGGGACCTAGCAAGCTCAGAACTCCAGACATG - UNI4932 - GATTTAGTCACCTATGATGACGT

GCATGTCAACTTCACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCT

ATAG GTTACATTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG - UNI1338 - GCGTGAAAGAAGTTGTACTGC

AGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTTGTAGTCAAAGGCATCAAATTAAACATACTGGAGAGAAACACCATGAC

TGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATCCATAATCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTA

AAGCGTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAG

CAGTCATCTCGGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGTAGTGGTGACCTCCAAAAA

CATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACGATGTGGTAAAGCCTTTGCAAGAAGCAGTGGTCTCCAATGTCATAAAAGATCACATA

CAGGAGAGACACCATATGAATGTAAACAAGGTGATAATCCCTTTGCAGGAAGCAGTGGTCTTGAATATCATAATCAAACACATACAGCTGAAAAACCCAG

GAATGTAACCAATGTGGTAAAGCCTTTGCAGGAAGGAATGACCTTTAAAGAGAAAAGACCATACAGGAGAGAAACTCTATGTAGGTATCTAATGTTATAA

AGCCTTTGCAGCAAGCATTGATCTCCAAGTACATAAATGAACATATACCAGAGAGGAACCTTTTAAATGTAACCAATGTGGTGAAGCTTTTTCGAAAACC

AATAGTCTTTACACACATAAAAGCACATATAGTTGAGAGAAATGCTTTGATTTTAACCAATGTGGTTAAAAATTTTCAAATAGCAGTCATAAACAAAATC

ATAAAAGAACACGTATAGGAGAGAGATTTTTGAATGCTAGCAATGGTGCCTTTACACCTTTTTCATGAAGCAGTGGCCTCCAAATATATAAAGGAACACA

TACAGGAGAGAAA
Translation
M - UNI4932 - DLVTYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR - UNI1338 - RRERSCTA

EQPSEFIQCGKAFAYESCSQRHQIKHTGEKHHDCNQCGKAFKRRSDLQIHNRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECKQCGKAFAQS

SHLGIHKRTHTGEKPYECNQCGKAFASSGDLQKHKRTHTGEKPYECKRCGKAFARSSGLQCHKRSHTGETPYECKQGDNPFAGSSGLEYHNQTHTAEKPR

NVTNVVKPLQEGMTFKEKRPYRRETLCRYLML
Transcript ENSMUST00000108968
Sequence
AGGGCCTCTACTGAGTGATGTGAGGGGACCTAGCAAGCTCAGAACTCCAGACATG - UNI4932 - GATTTAGTCACCTATGATGACGTGCATGTCAA

CTTCACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG GTTA

CATTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAGGTAA
Translation
M - UNI4932 - DLVTYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR
Transcript ENSMUST00000108967
Sequence
GATTTAGTCACCTATGATGACGTGCATGTCAACTTCACTCAGGAAGAATGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAG

AGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG - UNI1338 

- GCGTGAAAGAAGTTGTACTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTTGTAGTCAAAGGCATCAAATTAAAC

ATACTGGAGAGAAACACCATGACTGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGAGTGACCTCCAAATCCATAATCGAACACATACAGGAGAGAAACC

CTATGAATGTAAACAATGTGGTAAAGCGTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAA

TGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCGGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTG

CAAGTAGTGGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACGATGTGGTAAAGCCTTTGCAAGAAGCAGTGGTCT

CCAATGTCATAAAAGATCACATACAGGAGAGACACCATATGAATGTAAACAAGGTGATAATCCCTTTGCAGGAAGCAGTGGTCTTGAATATCATAATCAA

ACACATACAGCTGAAAAACCCAGGAATGTAACCAATGTGGTAAAGCCTTTGCAGGAAGGAATGACCTTTAAAGAGAAAAGACCATACAGGAGAGAAACTC

TATGTAGGTATCTAATGTTATAA
Translation
DLVTYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR - UNI1338 - RRERSCTAEQPSEFIQCGKAFA

YESCSQRHQIKHTGEKHHDCNQCGKAFKRRSDLQIHNRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLGIHKRTHTGEK

PYECNQCGKAFASSGDLQKHKRTHTGEKPYECKRCGKAFARSSGLQCHKRSHTGETPYECKQGDNPFAGSSGLEYHNQTHTAEKPRNVTNVVKPLQEGMT

FKEKRPYRRETLCRYLML

For any suggestions or comments, please send an email to unitrap@crg.es