Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078877 (OTTMUSG00000016219)
Chromosomal location
Chr 2: 176583317 - 176595928 (+)
Description
predicted gene, OTTMUSG00000016219 Gene [Source:MGI Symbol;Acc:MGI:3709624]
MGI
MGI:3709624 
Uniprot/SPTREMBL
A2BG90 A2BG91 
Human Ortholog
not available
Omim not available
UniTrap UNI36755
Vector Insertion
Chr 2: 176583424 - 176586885
Public Clones IST10103C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34803
Vector Insertion
Chr 2: 176586941 - 176592066
Public Clones IST14962B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108979
Sequence
CTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCC

AAACATG - UNI36755 - TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI34803 - GATTTAGTCA

CCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTACAG

GAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAACTTCTCGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTC

CAGAGCAACCCTCTGACTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTAGACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGA

CTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGT

AAAGTCTTTGCAAGAAGCTGTCATCTCCAAATACATAATCGAACACATGCAGGAGAGAAACATTATGAATGTAACCAATGTGGTAAAGCTTTTGAAAGAA

GGAGTCACCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGTCCTCCAAAA

ACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCACAAACATGAGCGAACACAT

ACAGGAGACAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAATCTCTACTCTCCAAATGCATAAGCGAACACATACAGGAGCCAAACCCT

ATGAATGTAAACAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAATGCATAAGCAAACACATACAGGAGAGAAACCCTATAAATGTAAACAATG

TGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGAAAAGCTTTTGCA

AGAAGTGGTGTCCTCCAACAACATAAACGCACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCC

GAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGACCTCCAACAACATAAACGAAC

ACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAA

CCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGATGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAAC

AATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTT

TGCAGAAAGCAGTACTCTCCAAATCCATAACCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGTGAC

CTCCAAAAACATAAACAAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACAAACATGAGC

GAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAACCGAACACATACAGGAGA

CAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGTAATCTCTACTCTCCAAATGCATAACCGAACACATACAGGAGAGAAACCATATGAATGT

AAACAATGTGGTAAAGCCTTTTCACATAGCAGTAATCTTCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAG

CCTTTGCAAGAAATGGTGACCTCCAAATACATAAACAAACACATACAGGAGAGAAACCGTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAG

TCATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCAT

AACCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAACCTTTGCAGAAAGCAGTACTCTCCAAATCCATAACCGAACACATACAG

GAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATTCAGGAGCAAATCCCTATGA

ATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAATACCTACAGGAGAGAGACCCTATGAATGTAACTAG
Translation
 - UNI36755 - M - UNI34803 - DLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR RHERS

CSPEQPSDFIQCGKAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKVFARSCHLQIHNRTHAGEKHYECNQCGKAF

ERRSHLQIHKRTHTGEKPYECNQCGKAFARSGVLQKHKRTHTGEKPYECKQCGKAFAQSSHLHKHERTHTGDKPYECKQCGKAFAVISTLQMHKRTHTGA

KPYECKQCGKAFAVIYTLQMHKQTHTGEKPYKCKQCGKAFARSCHLRIHKRTHTGEKPYECKQCGKAFARSGVLQQHKRTHTGEKPYECKQCGKAFAQSS

HLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSDDLQKHKRTHTGEKPYE

CKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFARSGDLQKHKQTHTGEKPYECKQCGKAFAHSSHLHK

HERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFAVISTLQMHNRTHTGEKPYECKQCGKAFSHSSNLRIHKRTHTGEKPYECNQC

GKAFARNGDLQIHKQTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKTFAESSTLQIHNRT

HTGEKPYECKQCGKAFASSSDLQKHKRTHSGANPYECKQCGKAFAQSSHLRIHKQIPTGERPYECN
Transcript ENSMUST00000118012
Sequence
CTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCC

AAACATG - UNI36755 - TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI34803 - GATTTAGTCA

CCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTACAG

GAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAACTTCTCGAAGTCATGGAAGGTAATTTTACTCTGCAAGCTG

AGGAGAAAATGCCTATGAAGAAAGTTTAACTTGTGGTACAAGTAGTAAAGAAAACCAATAGGGTACAATAAGCACTGCTTTCAGTGATGGATGTTTACTG

ACTTTCATAAAAATCATATATGTTTATGGCAGATATGTAACTGTTGTTTGCAAGACATTCCATTAGGTCAAAGACAGAGAAATAATGGCTTAACACATAT

GTTACTGTTTAAATCAAGCCTAGTACAGCCATGCTATACAAGTGTGAGTGTCTTCAGTCTTATATCGCTTAGCTATTGCAAAAGGAACACATAGTGATTA

GGTGACAAGTATATGTCTAAAACCTAGTAATGAGCAAATAATCCATAGTATATCTGAGCTCAATGATATACTTGTAATAACATTGCTAAATTTAGTGAGA

TGAACAGTTCATAAGATTCAAAAATGGTTTTGTGGAAAAACCTTAATCTCTGTACCACATCTCTGTGACAAAAAAAAGTCAGCTGTGAATGTAATGTGGA

ATTTTCACTTGTTATTCTTCTTTTGATGTGGATGTCATAGGTTACAATTGATACAAGCCTTGTGATCACTGGGGCATTGAAAGAAGCCACATACCTTTCA

CTTTTCCAGAACAATTAGAGGATATGCAGTATAACATATTTTGAACAACATACTTAATGTGCTATATAAGTTTATAAAAAATTTGTTTCCGAACATTGCT

GGGAACATTTACCAACTCTAACTGCTGAAAATAGTAATGAGAATTAAGGCAGTAGAAAATTTTTTTCTTTTGCATTTGTTCATATTCCAAATGTAGTATT

ACTCTCATGATAACAAAATTTGTGAATGCAATCATTGTGCAAACACTGTGAGTTCTTCCTGTTTTTTTCAAATATGTGAGTAACCTTTTATAGAAAAAGT

ATGTTATAAATGTGAGCCTGATAATCAATACTGTTCCCATTTCATATATCCTCGAAGATGTAAACAATTCATAATTTAGTAGAACTCCTTTGAATATAAA

CAAAGTAATATTATGTTAACATTAGATTGCTCTGTTCAATGA
Translation
 - UNI36755 - M - UNI34803 - DLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es