Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078878 (RP24-562O19.4)
Chromosomal location
Chr 2: 176492971 - 176507195 (+)
Description
predicted gene, OTTMUSG00000016609  [Source:RefSeq peptide;Acc:NP_001093886]
Human Ortholog
not available
Omim not available
UniTrap UNI38099
Vector Insertion
Chr 2: 176496645 - 176503665
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108983
Sequence
CCACATGGACCTGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGATCATGAGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACGTG TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAA

GCTCAGAACTTCACACATG - UNI38099 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTT

CTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAAGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTC

AAACTTCTCGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTA

GACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATG CAGTGGCCTCCAAATATATAAAG

GAACACATACAGGAGAGAAACCCTATGAATATTGGCAATGTTTTAAAACACTTCTACATCACAATCATCTTCAAATCTGTAAGGAACATGAGGTTTTGAG

AAATCCTCTGAATAATACCAATTAG
Translation
 M - UNI38099 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPSEFIQCG

KAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTC CSGLQIYKGTHTGEKPYEYWQCFKTLLHHNHLQICKEHEVLRNPLNNTN
Transcript ENSMUST00000108981
Sequence
CCACATGGACCTGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGATCATGAGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACGTG TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAA

GCTCAGAACTTCACACATG - UNI38099 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTT

CTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAAGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTC

AAACTTCTCGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTA

GACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCG

AACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGTCTTTGCAAGAAGCTGTCATCTCCAAATACATAATCGAACACATGCAGGAGAG

AAACAGTATGAATGTAACCAATGTGGTAAAGCTTTTAAAAGAAGGATTAACCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTA

ACCAATGTGGAAAAGCCTTTGCAAGTAGTGGTGAACTCCAAAACCATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGC

CTTTTCACAAAGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCCTTTGCAAGAAGTGGT

GACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCACAAACATG

AGCGAACACATACAGGAGACAAACCCTATGAATGTAAACAGTGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAATGCATAAGCGAACACATACAGG

AGAGAAACCCTATAAATGTAAACAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAATGCATAAGCGAACACATACAGGAGAGAAACCCTATAAA

TGTAAACAATGTGGTAAAGCCTTTGCAAGAAGCTGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTA

AAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAACCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAACAAG

GAGAGTCCTCCAAATACATAAGGGAACACATACCGGAGAGAAACCCTATGAATGTAACCAATGTGGAAAAGCTTTTGCAAGAAGTTGTGACCTCCAAAAA

CATAAACGAACTCATACAGGAGAGAAACCCTATGAATGTAACCACTGTGGTAAAGCCTTTGCACAAAGCAGTTCTCTCCGAATCCATAAGCGAACACATA

CAGGAGAGAGACAATATGAATGTAACTAG
Translation
 M - UNI38099 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPSEFIQCG

KAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKVFARSCHLQIHNRTHAGEKQYECNQCGKAFKRRINLQIHKRTH

TGEKPYECNQCGKAFASSGELQNHKRTHTGEKPYECKQCGKAFSQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQKHKRTHTGEKPYECKQCGKAFA

HSSHLHKHERTHTGDKPYECKQCGKAFAVIYTLQMHKRTHTGEKPYKCKQCGKAFAVIYTLQMHKRTHTGEKPYKCKQCGKAFARSCHLRIHKRTHTGEK

PYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFITRRVLQIHKGTHTGEKPYECNQCGKAFARSCDLQKHKRTHTGEKPYECNHCGKAFAQSSS

LRIHKRTHTGERQYECN
Transcript ENSMUST00000099012
Sequence
CCACATGGACCTGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGATCATGAGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACGTG TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAA

GCTCAGAACTTCACACATG - UNI38099 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTT

CTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAAGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTC

AAACTTCTCGAAGTCATGGAAG AT ATAAAAAGACTCAT
Translation
 M - UNI38099 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG GYIWEEHTIEDHFQTSRSHGR RY YKKTH
Transcript ENSMUST00000108980
Sequence
TTTCTGTAACTCAGCGATCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAAC

GTG TGTCTTCGCTGGATGCTGTGAATTTAGCTCAAGCAAGCTCAGAACTTCACACATG - UNI38099 - GATTTAGTCACCTATGATGACGTGCAT

GTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAGGGTGTGATGCTAGAGACCTATAAGAATCTCACAGCTATAG

 GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTCAAACTTCTCGAAGTCATGGAAGGTAATTTTACTCTGCAAGCTGAGGAGAAAATGCCTATG

AAGAAAGTTTAACTTGTGCTACAAGTAGTAAAGAAAACCAATAGGGTACAATAAGCACTGCTTTCAGTGATGGATGTTTACTGACTTTCATAAAAATCAT

ATATGTTTATGGCAGATATGTAACTGTTGTTTGCAAGACATTCCATTAGGTCAAAGACAGAGAAATAATGGCTTAACACATATGTTACTGTTTAAATCAA

GCGTAGTACAGCCATGCTATACAAGTGTGAGTGTCTTCAGTCTCATATCGCTTAGCTATTGCAAAAGGAACACACAGTGATTAGGTGACAAGTATATGTC

TAAAACCTAGTAATGAGCAAATAATCCATAGTGTATCTGAGCTCAATGATATACTTGTAATAACATTGCTAAATTTAGTGAGATGAACAGTTCATAAGAT

TCAAAAATGGTTTTGTGGAAAAACCTTAATCTCTGTACCACATCTCTGTGACAAAAAAAAGTCAGCTGTGAATGTAATGTGGAATTTTCACTTGTTATTC

TTCTTTTGATGTGGATGTCATAGGTTACGATTGATACAAGCCTTGTGATCACTGGGGCATTGAAAGAAGCCACATACCTTTCACTTTTCCAGAACAATTA

GAGGATATGCAGTATAACATATTTTGAACAACATACTAAATGTGCTATATAAGTTTATAAAAAATTTGTTTCCGAACATTGCTGGGGACATTTACCAACT

CTAACTGCTGAAAATAGTAATGAGAATTAAGGCAGTAGAAATTTTTTTTTTCTTTTGCATTTGTTCATATTCCAAATGTAGTATTACTCTCATGATAACA

AAATTTGTGAATGCAATCATTGTGCAAACACTGTGAGTTCTTCCTGTTTTTTTTCAAATATGTGAGTAACCTTTTATAGAAAAAGTATGTTATAAATGTG

AGCCAGATAATCAATACTGTTCCCATTTCATATATCCTCGAAGATGTAAAACAATTCATAATTTAGTAGAACTCCTTTGAATATAAACAAAGTAATATTA

TGTTAACATTAGATTGCTCTGTTCAATGAAACCAAAATTTAAAACAATTCATACAGATAAAAAGACTCATC
Translation
 M - UNI38099 - DLVTYDDVHVNFTQDEWALLDPSQKSLYKGVMLETYKNLTAIG GYIWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es