Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078887 (AL845476.15-202)
Chromosomal location
Chr 2: 175868351 - 175884150 (+)
Description
KRAB box and zinc finger, C2H2 type domain containing  [Source:RefSeq peptide;Acc:NP_001092778]
RefSeq_peptide
NP_001092778.1 
Uniprot/SPTREMBL
A2ARX2 Q8C1K5 A2ART0 A2ARX1 
Human Ortholog
not available
Omim not available
UniTrap UNI33884
Vector Insertion
Chr 2: 175868514 - 175872180
Public Clones IST11571E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38678
Vector Insertion
Chr 2: 175872236 - 175877360
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099026
Sequence
CCACATGGACCAGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI33884 - TGTCTTCGCTGGATGCTGTGAAT

TTAGCTCAAGCAAGCTCAGAACTTCACACATG GATTTAGTCACCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTT

CTCAGAAGAGTCTCTACAAAGATGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTC

AAACTTCTAGAAGTCATGGAAG ACTCCAAAGTACTTGTATGCTGAGCTAA
Translation
 - UNI33884 - M DLVTYDDVQVNFTQDEWALLDPSQKSLYKDVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR RLQSTCMLS
Transcript ENSMUST00000109012
Sequence
CCACATGGACCAGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI33884 - TGTCTTCGCTGGATGCTGTGAAT

TTAGCTCAAGCAAGCTCAGAACTTCACACATG GATTTAGTCACCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTT

CTCAGAAGAGTCTCTACAAAGATGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTC

AAACTTCTAGAAGTCATGGAAG GCATGAAAGAAGTTGTTCTGCAGAGCAACCCTCTGAGTTTATTCAATGTGGTAAAGCCTTTGCATATGAGAGTGGTA

GACAAAGGCATCAAATTAAACATAATGGAGAGAAACACCATGACTGTAACCAATGTGGTAAGGACTTTAGAACATGGAATGTCCTGCAAATACATAAGCG

AACACATACAGGAGAGAAACCCTATGACTGTAAACAATGTGGTAAAGTCTTTGCAAGAAGCTGTCATCTCCAAATACATAATCGAACACATGCAGGAGAG

AAACAGTATGAATGTAACCAATGTGGTAAAGCTTTGAAAAGAAGGAGTGACCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTA

ACCAATGTGGAAAAGCCTTTGCAAGTAGTGGTGACCTCCAACAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGC

CTTTTCAGAATGCAGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGT

CATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAATGCATA

AGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAATGCATAAGCGAACACATACAGG

AGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGTAATCTATACTCTCCAAAGGCATAAGCAAACACATACAGGAGAGAAACCCTATAAA

TGTAAACAATGTGGTAAAGCCTTTACAAGAAGCTGTCATCTCCGAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGAA

AAGCCTTTGCAAGAAGTGGTGACCTCCAAAAACATAAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAG

CAGTCATCTCCACAAACATGAGCGAACACATACAGGAGACAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATC

CATAACCGAACACATACAGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCTTTTATAACAAGGAGAGTCCTCCAAATACATAAGCGAACACATA

CCGGAGAGAAACCATATGAATGTAAACAATGTGGTAAAGCCTTCGCAAGCAGTAGTGACCTCCAAAAACATAAACGAACACATTCAGGAGCGAAACCCTA

TGAATGTAAACAATGTGGTAAAGCTTTTGCACAAAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAGAGACCCTATGAATGTAACTAG
Translation
 - UNI33884 - M DLVTYDDVQVNFTQDEWALLDPSQKSLYKDVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR RHERSCSAEQPSEFIQCG

KAFAYESGRQRHQIKHNGEKHHDCNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKVFARSCHLQIHNRTHAGEKQYECNQCGKALKRRSDLQIHKRTH

TGEKPYECNQCGKAFASSGDLQQHKRTHTGEKPYECKQCGKAFSECSHLRIHKRTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFA

VIYTLQMHKRTHTGDKPYECNQCGKAFAVIYTLQMHKRTHTGDKPYECNQCGKAFAVIYTLQRHKQTHTGEKPYKCKQCGKAFTRSCHLRIHKRTHTGEK

PYECNQCGKAFARSGDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRTHTGEKPYECNQCGKAFITRRV

LQIHKRTHTGEKPYECKQCGKAFASSSDLQKHKRTHSGAKPYECKQCGKAFAQSSHLRIHKQTHTGERPYECN
Transcript ENSMUST00000109011
Sequence
CCACATGGACCAGCCAGTCAGAAGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCGGTCATGGGAGTTTCTGTGTGATGT

GTTCTGCGTGACTCTACTGGGTGTTGTGAGAGAAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI33884 - TGTCTTCGCTGGATGCTGTGAAT

TTAGCTCAAGCAAGCTCAGAACTTCACACATG GATTTAGTCACCTATGATGACGTGCAGGTGAACTTCACTCAGGATGAGTGGGCTTTGCTGGATCCTT

CTCAGAAGAGTCTCTACAAAGATGTGATGCTAGAGACCTATAGGAATCTCACAGCTATAG GTTACATTTGGGAAGAACATACGATTGAAGACCATTTTC

AAACTTCTAGAAGTCATGGAAGGTAATTTTACTCTGCAAGCTGAGGAGAAAATGCCTATGAAGAAAGTTTAACTTGTGGTACAAGTAGTAAAGAAAACCA

ATAGGGTACAATAAGCACTGCTTTCAGTGATGGATGTTTACTGACTTTCATAAAAATCATATATGTTTATGGCAGATATGTAACTGTTGTTTGCAAGACA

TTCCATTAGGTCAAAGACAGAGAAATAATGGCTTAACACATATGTTACTGTTTAAATCAAGCCTAGTACAGCCATGCTATACAAGTGTGAGTGTCTTCAG

TCTCATATCACTTAGCTATTGCAAAAGGAACACACAGTGATTAGGTGACAAGTATATGTCTAAAACCTAGTAATGAGCAAATAATCCATAGTATATCTGA

GCTCAATGATATACTTGTAATAACATTGCTAAATTTAGTGAGATGAACAGTTCATAAGATTCAAAAATGGTTTTGTGGAAAAACCTTAATCTCTATACCA

CATCTCTGTGACAAAAAAAAGTCAGCTGTGAATGTAATGTGGAATTTTCACTTGTTATTCTTCTTTTGATGTGGATGTCATAGGTTACGATTGATACAAG

CCTTGTGATCACTGGGGCATTGAAAGAAGCCACATACCTTTCACTTTTCCAGAACAATTAGAGGATATGCAGTATAACATATTTTGAACAACATACTAAA

TGTGCTATATTAGTTTATAAAAAATTTGTTTCCGAACATTCCTGGGGACATTTACCAACTCTAACTGCTGAAAATAGTAATGAGAATTAAGGCAGTAGAA

ATTTTTTTTTCTTTTGCATTTGTTCATATTCCAAATGTAGTATTACTCTCATGATAACAAAATTTGTGAATGCAATCATTGTGCAAACACTGTGAGTTCT

TCCTGTTTTTTTTCAAATATGTGAGTAACATTTTATAGAAAAAGTATGTTATAAATGTGAGCCTGATAATCAATACTGTTCCCATTTCATATATCCTCGA

AGATGTAAAACAATTCATAATTTATTAGAACTCCTTTGAATATAAACAAAGTAATATTATG
Translation
 - UNI33884 - M DLVTYDDVQVNFTQDEWALLDPSQKSLYKDVMLETYRNLTAIG GYIWEEHTIEDHFQTSRSHGR

For any suggestions or comments, please send an email to unitrap@crg.es