Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000078889 (OTTMUSG00000016618)
Chromosomal location
Chr 2: 175690698 - 175930258 (-)
Description
predicted gene, OTTMUSG00000016199 Gene [Source:MGI Symbol;Acc:MGI:3706570]
RefSeq_peptide
NP_001028295.2 
UniGene
Mm.422667 Mm.444548 Mm.455970 Mm.459198 
MGI
MGI:3702430 MGI:3782903 MGI:3706570 
Uniprot/SPTREMBL
A2ART1 A2ART2 A3KQJ7 Q3V498 A2ARS7 A2CF17 
Human Ortholog
not available
Omim not available
UniTrap UNI2010
Vector Insertion
Chr 2: 175800090 - 175800161
Public Clones AZ0500 (sanger) RRI486 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8997
Vector Insertion
Chr 2: 175791665 - 175791869
Public Clones XF504 (baygenomics) XF180 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17437
Vector Insertion
Chr 2: 175694846 - 175702718
Public Clones not available
Private Clones OST443021 (lexicon) OST276632 (lexicon) OST258024 (lexicon) OST197917 (lexicon)
OST186285 (lexicon) OST107605 (lexicon) OST63925 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109018
Sequence
GGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTT

GTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG

 CCTTTGCAGGAAGGAGTGACCTCCAAAGACAAAAGATCATACAGAAGAGAAAGTCTACGAAGGCATCTAATGTTATAAAGTCTTTGCAGCAAGCATTGA

TCTCCATGTATATAAATGAACACATACCAGAGAGGAACCTTTTAAATGTAACCAACATGGTAAAGCTTTTTCAAAAACCAATAGTCTTTACATACATAAA

AGAATATATACTTGAGAGAAATGCTTTGACTTTAACCAATGTGGTTAAACTTTTTCAGAAAGCAGTCATCAACAAAATCATAAAACAACACGTATAG
Translation
MRDSTGCCERRLVKLRTPNM VTVGKNIQLKTISKLLEVMEA AFAGRSDLQRQKIIQKRKSTKASNVIKSLQQALISMYINEHIPERNLLNVTNMVKLF

QKPIVFTYIKEYILERNALTLTNVVKLFQKAVINKIIKQHV
Transcript ENSMUST00000099025
Sequence
GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAG

AGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG ATTCTCAAAT

CTTTATCATTATGAAAGAGAAACCCTATGA
Translation
DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSRSHGR RFSNLYHYERETL
Transcript ENSMUST00000109017
Sequence
GGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTT

GTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGG

ATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACC

ATTTCCAAACTTCTAGAAGTCATGGAAG GCATGAAAGACGTTCTTCTGCAGAGCAACACTCTGAGTTTATTCCATGTGGTAAAGCCTTTGCATATCAGA

GTCGTAGTCAAAGGCATGTAAGAATACACAATGGAGAGAAACACTATGAGTGTAACCAATGTGGTAAAGACTTTGGAACAAGGAGTGTCCTCCAAAGACT

TAAACGAACACATACAGGAGAAAAACCCTATGAATGTAACCACTATGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAAGCGAAAACATACA

GGAGAGAAACCATATGAATGTAACCACTGTGTTAAAGCCTTTGCAAAAATGAGTAAACTCCAAATACATAAACGAATACATACAGGAGAGAAACCCTATG

AATGTAAGCAATGTGGTAAAGCCTTTACACAAAGCAGTCATCTCGGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGG

TAAAGCCTTTACACGAAGCAGTACTCTCCAAACCCATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGATAAAGCTTTTGTAAGA

AGGGGAGAACTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTGCACAAAGTGGTACTCTCCAAA

TCCATAAGCGAACACATACTGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTGCACATAGCAGTACTCTCCAAATCCATAAGCGAACACA

TACAGGAGAGAAACCGTATGAATGTAAACAGTGTGATAAAGCTTTTGTAAAAAGGGGAGAACTCCAAATCCATAAGCAAACACATACAGGAGAGAAACCC

TATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGTGGTACTCTCCAAGTACATGAGCGAACACATACAGGAGAGAAACCCTTTGAATGTAACCAAT

GTGGTAAAGCCTTTGTACAATGCATTGCTCTCCGAATACATGAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGC

ACATAGCAATACTCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTACTCTC

CAAATACATAAGCAAACACATACAGGAGAGAAACCATAA
Translation
MRDSTGCCERRLVKLRTPNM DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSRSHGR RHERRSSAEQHSE

FIPCGKAFAYQSRSQRHVRIHNGEKHYECNQCGKDFGTRSVLQRLKRTHTGEKPYECNHYGKAFAESSTLQIHKRKHTGEKPYECNHCVKAFAKMSKLQI

HKRIHTGEKPYECKQCGKAFTQSSHLGIHKRTHTGEKPYECKQCGKAFTRSSTLQTHKQTHTGEKPYECKQCDKAFVRRGELQIHKRTHTGEKPYECKQC

GKAFAQSGTLQIHKRTHTGEKPYECKQCGKAFAHSSTLQIHKRTHTGEKPYECKQCDKAFVKRGELQIHKQTHTGEKPYECKQCGKAFAQSGTLQVHERT

HTGEKPFECNQCGKAFVQCIALRIHERTHTGEKPYECKQCGKAFAHSNTLQIHKRTHTGEKPYECKQCGKAFAHSSTLQIHKQTHTGEKP
Transcript ENSMUST00000109020
Sequence
GTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI2010 - GATTTACTCACCTATGA

TGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTC

ACAGCTATAG - UNI8997 - GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAGGTAATTTTCCTCTGCA

AGCTGATGAGAAAATGCCTATGAAGAAAGTTTAACGTGTGCTACAAGTAGTAAAGAAAACCAATAGGGTACAATAAGCACTGCTTTCAATTATGGATGTT

TACTGACTTTCATAAAATCATATATGTCTATGTCAAATACGTAATTATTGTTTGCAAGGCATTCCATTAGTTCAAAGACAGAGAAATAATGGCTTAACAG

GTATGTTACTATTTAAATCAAGCTTAGTAGAGCCATGCTGTACAAGTGCGAGTGTCTTCAGTCTCATATCGCTTAGCTATTGCAAAAGGAACACACAGTG

ATTAGGTGACAAGTATATGTCTAAAACCTAGTAATAAGCAAATAATCCATAGTATATCTGAGCTCAATGATATACTTGTAATATCATTGCTAAATTTAGT

GAGATGGACAGTTCATAAGATTCAAAAATGGTTTGGTGATAAAACCTTAATCGCTATACTACATCTCTATGAGGAAAAAAGTCACGTGTGTGAATGTAAT

ATGGAACCTTTACACTTGTTATTCTCTTTTAATATGGTTGTCATACGTTACTATGGATACAGCCCTTGTGAGCATAGGGGTATTGAAAGATGCCACATAC

CTTTCACTTTTTCAGAACAACAAGAGGATATGCAGTATAACATACTTTGAGTGACATTCTAAATGTGCTGTAAGTTTATAAGTACTTAGTTTCCCAACAT

TATTGGGGACATTTTCCAACTCAAACTGCTGAAAATCATAATTAGAATTAGGGTAGTAGAAATTATATTCTGTTTGCATTTGTTCATGTTCCAAATGTAG

TATTACTCTCATGATAACAAAATTTGTGAATGCAATCAGTGTGCAAAGACTTTGAGTTCTTCCTGTTTTTTTCAAATATGTGAATAACCTTTTATACAAA

AAGTATGCTATAAATGTGAGCCAGATAATCAATACTGTTCCCATTTCATGTATCCTCAAAGATGTAAAACAATCCATAACGAGGAGAACACCTTTGAATG

CAAACAAAGGCATATTACATTAACATTAGATTGCTCTTTTGAATGAAGCCAATTTTTAAAAGAATTCATACAGATAAAAAGACTCATCAGTATAATCAAT

GCGAGAACAATTTCACGTGTGCCAATTGTATTTGCAGGCATGAAAGAAGTTCTTCTGCAGAGCAACACTCTGAGTTTATTCAATGTGGTAAAGCCTTTGC

ATATCAGTCATAGTCAAAGGCATGTAAGAATACACAATGGAGAGAAACACTGTGAGTGTAACCAATGTGGTAAAGACTTTGGAACAAGGAGTGTCCTCCA

AAGACTTAAACGAACACATACAGGAGAGAAACCCTATGAATGTAACCACTGTGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAAGCGAAAA

CATACAGGAGACGAACCATATGAATGTAACCACTGTGTTAAAGCCTTTGCAAAAATGAGTGAACTCCAAATACATAAACGAATACATACAGGAGAGAAAC

CCTATGAATGTAAGCAATGTGGTAAAGCCTTTACACAAAGCAGTCATCTCGGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACA

ATGTGATAAAGCTTTTGTAAGAAGGGGAGAACTCCAAATCCATAAGTGAACACATACAGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTT

GCACAAAGCGGTACTCTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGTGGTACTC

TCCAAGTACATGAGCGAACACATACAGGAGAGAAACCCTTTGAATGTAACCAATGTGGTAAAGCCTTTGTACAATGCATTGCTCTCCGAATACATGAACG

AACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTCATCTCCGAATACATAAGCAAACACATACAGGAGAG

AAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACATAGCAGTACTCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCATAAGAATGTA

AACAATGTGGTAAAGCTTTTAAAAGAAGTGGTGACCTTCTAATACATAAGCGAACACATACATGAGAGAAACCCTGTGAATGTAAGAAATGTGGTAAAGT

TTTTATAAGAAGTGTTGACCTTCAAATACATAAGTGAAGACATTAGGAGATAAACCCTATGAATGTAAACAATGTGGTAAAGCTTTGCAGAAAGCAGTAC

TCTCCAGATACATAAGCGAACACATACAGGAGAGAGACCCTATGAATGTAACTAGTGTGGTAAAGCCTTTGCAGGAAGGAGTGACCTGCAAAGACAAAAG

ATCATACAGAAGAGAAAGTCTATGAAGGCATCTAATGTTATAAAGTCTTTGCAGCAAGCATTGATCTCCACGTATATAAATGAACACATACCAGAGAGGA

ACCTTTTAAATGTAACCAACATGGTAAAGCTTTTTCAAAAACCAATAGTCTTTACATACATAAAAGAATATATACTTGAGAGAAATGGTTCGACTTTAAC

CAATGTGGTTAAACTTTTTCAAAAGCAGTCATCAACAAAATCATAAAACAACACGTATAGGAGAGAGATTTTTGAATGTTAGCAATGTGCTTTTACACCT

TTTTTCACAAAACAGTGGCCTCAAAATATATAAGGAAACACGTACTGGAGAGAAAACCTATGAATATCAGCAATGTCCTGAAACCCTTCTACATCACAAT

CATCTTCAAATCCATAAAGAACATGTAGTGGAGAAAAATCCTCTGAATATCACTAATTAGGTAAAGCAGTTATAAAGAGTCATCTCCTAACACAAAAGTA

TACACACTGGATAGAAACCCTATGAATATAAGCAATGTGGTAAATGTTTTATAAGTCACAGTATTCTCTAAGTAAATAAAGGAAGACACACTTGAGAGAA

ACCCTATGAAAATTATTAAAGGTACAAAGCCTTGTACATTAAAATCTTCAAATCAATAAAAGAAGACATAGAGGTGAGAAACCCTATGTTTGCAAGCCA
Translation
M - UNI2010 - DLLTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG - UNI8997 - GYSWEEHTIEDHFQTSRSHGR
Transcript ENSMUST00000109022
Sequence
AGAGGAGGCGGCTCTTCCAGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGT

GTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI2010 - GATTTACTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAG

AGTGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG - UNI8997 - GTTACA

GTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG AGTCTTCACAATGAAACAATCCATACTGCCAAGAAATTTAGGAA

TATAATATGGTGAAACCTTTTCAGATTCTCAAATCTTTATCATTATGAAAGAGAAACCCTATGAATGCATTAAATATGGGGAAGCCTTTAAACATTACTA

ATTCTTCATCATCATTAAAATAATCATACAAAGGATTCAAGAGGATACAGGGGTGTTTCTTACTGTATTGCTTGAGTTACAGTCCTGACATCCTTTGGTG

ATCAACAGCAATTTGGAAAGTGTAAGCTGAAGAAACCCTTTCCTCCCCTCTGCTTCTTGCTCATCATGTT
Translation
M - UNI2010 - DLLTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG - UNI8997 - GYSWEEHTIEDHFQTSRSHGR RVFTMKQS

ILPRNLGI
Transcript ENSMUST00000109023
Sequence
GGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTT

GTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI2010 - GATTTACTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGT

GGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG - UNI8997 - GTTACAGTT

GGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG AGTCTTCACAATGAAACAATCCATACTGCCAAGAAATTTAGGAATAT

AA
Translation
M - UNI2010 - DLLTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG - UNI8997 - GYSWEEHTIEDHFQTSRSHGR RVFTMKQS

ILPRNLGI
Transcript ENSMUST00000109025
Sequence
GTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG -

 UNI2010 - - UNI8997 - - UNI17437 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATG

CTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACCATT

TCCAAACTTCTAGAAGTCATGGAAGGTAATTTTCCTCTGCAAGCTGATGAGAAAATGCCTATGAAGAAAGTTTAACGTGTGCTACAAGTAGTAAAGAAAA

CCAATAGGGTACAATAAGCACTGCTTTCAGTTATGGATGTTTATTGAATTTCATAAAATCATATATGTCTATGGCAGATATGTAATTATTGTTTGCAAGA

CTTTCCATTAGTTCAAAGACAGAGAAATAATGGCTTAACAGGTATGTTACTGTTTAAATCAAGCCTAGTAGAGCCATGCTGTACAAGTGTGAGTGTCTTC

AGTCTCATATCGCTTAGCTATTGCAAAAGGAACACACAGTGATTAGGTGACAAGTATATGTCTAAAACCTAGTAATAAGCAAATAATCCATAGTATATCT

GAGCTCAATGATATACTTGTAATATCATTGCTAAATTTAGTGAGATGGACAGTTCATAAGATTCAAAAATGGTTTGGTGGAAAAACCTTAATCGCTATAC

TACATCTCTATGAGGAAAAAAGTCACGTGTGTGAATGTAATATGGAACCTTTACACTTGTTATTCTCTTTTAATATGGTTGTCATACGTTACTATGGATA

CAGCCCTTGTGAGCATAGGGGTATTGAAAGATGCCACATACCTTTCAATTTTTCAGAACAACAAGAGGATATGCAGTATAACATACTTTGAGTGACATTC

TAAATGTGCTGTAAGTTTATAAGTACTTAGTTTCCCAACATTATTGGGGACATTTACCAACTCAAACTACTGAAAATCATAATGAGAATTAGGGTAGTAG

AAATTATATTCTGTTTGCGTTTGTTCACGTTCCAAATGTAGTATTACTCTCATGATAACAAAATTTGTGAATGC
Translation
M - UNI2010 - - UNI8997 - - UNI17437 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSR

SHGR
Transcript ENSMUST00000109026
Sequence
GGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTT

GTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI17437 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAG

TGGGCTTTGCTGGATGCTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACAT

ACAATTGAAGACCATTTCCAAACTTCTAGAAGTCATGGAAG GCATGAAAGACGTTCTTCTGCAGAGCAACACTCTGAGTTTATTCCATGTGGTAAAGCC

TTTGCATATCAGAGTCGTAGTCAAAGGCATGTAAGAATACACAATGGAGAGAAACACTATGAGTGTAACCAATGTGGTAAAGACTTTGGAACAAGGAGTG

TCCTCCAAAGACTTAAACGAACACATACAGGAGAAAAACCCTATGAATGTAACCACTATGGTAAAGCCTTTGCAGAAAGCAGTACTCTCCAAATCCATAA

GCGAAAACATACAGGAGAGAAACCATATGAATGTAACCACTGTGTTAAAGCCTTTGCAAAAATGAGTAAACTCCAAATACATAAACGAATACATACAGGA

GAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTACACAAAGCAGTCATCTCGGAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAAT

GTAAACAATGTGGTAAAGCCTTTACACGAAGCAGTACTCTCCAAACCCATAAGCAAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGATAA

AGCTTTTGTAAGAAGGGGAGAACTCCAAATCCATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTGCACAAAGT

GGTACTCTCCAAATCCATAAGCGAACACATACTGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCCTTTGCACATAGCAGTACTCTCCAAATCC

ATAAGCGAACACATACAGGAGAGAAACCGTATGAATGTAAACAGTGTGATAAAGCTTTTGTAAAAAGGGGAGAACTCCAAATCCATAAGCAAACACATAC

AGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACAAAGTGGTACTCTCCAAGTACATGAGCGAACACATACAGGAGAGAAACCCTTT

GAATGTAACCAATGTGGTAAAGCCTTTGTACAATGCATTGCTCTCCGAATACATGAACGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTG

GTAAAGCCTTTGCACATAGCAATACTCTCCAAATACATAAGCGAACACATACAGGAGAGAAACCCTATGAATGTAAACAATGTGGTAAAGCCTTTGCACA

TAGCAGTACTCTCCAAATACATAAGCAAACACATACAGGAGAGAAACCATAA
Translation
MRDSTGCCERRLVKLRTPNM - UNI17437 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSRSHGR 

RHERRSSAEQHSEFIPCGKAFAYQSRSQRHVRIHNGEKHYECNQCGKDFGTRSVLQRLKRTHTGEKPYECNHYGKAFAESSTLQIHKRKHTGEKPYECNH

CVKAFAKMSKLQIHKRIHTGEKPYECKQCGKAFTQSSHLGIHKRTHTGEKPYECKQCGKAFTRSSTLQTHKQTHTGEKPYECKQCDKAFVRRGELQIHKR

THTGEKPYECKQCGKAFAQSGTLQIHKRTHTGEKPYECKQCGKAFAHSSTLQIHKRTHTGEKPYECKQCDKAFVKRGELQIHKQTHTGEKPYECKQCGKA

FAQSGTLQVHERTHTGEKPFECNQCGKAFVQCIALRIHERTHTGEKPYECKQCGKAFAHSNTLQIHKRTHTGEKPYECKQCGKAFAHSSTLQIHKQTHTG

EKP
Transcript ENSMUST00000109027
Sequence
GGAGGCGGTTCTTCCGGGTCAAGCTTGCAAGCTCCTTTCTGTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTATGCGTGACTCTACTGGGTGTT

GTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG - UNI17437 - GTTACAGTTGGGAAGAACATACAATTGAAGACCATTTCCAAACTTCTA

GAAGTCATGGAAG CCTTTGCAGGAAGGAGTGACCTCCAAAGACAAAAGATCATACAGAAGAGAAAGTCTACGAAGGCATCTAATGTTATAAAGTCTTTG

CAGCAAGCATTGATCTCCATGTATATAAATGAACACATACCAGAGAGGAACCTTTTAAATGTAACCAACATGGTAAAGCTTTTTCAAAAACCAATAGTCT

TTACATACATAAAAGAATATATACTTGAGAGAAATGCTTTGACTTTAACCAATGTGGTTAAACTTTTTCAGAAAGCAGTCATCAACAAAATCATAAAACA

ACACGTATAG
Translation
MRDSTGCCERRLVKLRTPNM - UNI17437 - VTVGKNIQLKTISKLLEVMEA AFAGRSDLQRQKIIQKRKSTKASNVIKSLQQALISMYINEHIPE

RNLLNVTNMVKLFQKPIVFTYIKEYILERNALTLTNVVKLFQKAVINKIIKQHV
Transcript ENSMUST00000109028
Sequence
GTAACTCAGCAGTCATGAGAGTTTCTGTGTGATGTGTTCTGCGTGACTCTACTGGGTGTTGTGAGAGGAGGTTAGTCAAGCTCAGAACTCCAAACATG -

 UNI2010 - - UNI8997 - - UNI17437 - GATTTAGTCACCTATGATGACGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATG

CTTCTCAGAAGAGTCTCTACAAAGGTGTGATGGTAGAGACCTATAGGAATCTCACAGCTATAG GTTACAGTTGGGAAGAACATACAATTGAAGACCATT

TCCAAACTTCTAGAAGTCATGGAAG ATTCTCAAATCTTTATCATTATGAAAGAGAAACCCTATGA
Translation
M - UNI2010 - - UNI8997 - - UNI17437 - DLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIG GYSWEEHTIEDHFQTSR

SHGR RFSNLYHYERETL

For any suggestions or comments, please send an email to unitrap@crg.es